SecReT4
Protein ID: 308183814
T4SS name [ID]ComB [440]
Gene symbol-
Locus tagHPSJM_00090
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]14094..14357 [+]
Producthypothetical protein
Component typeComB3
UniProt IDE1Q0V2
KEGG IDhpm:HPSJM_00090
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 87 a.a.     [Download]
>gi|308183814|ref|YP_003927947.1| hypothetical protein HPSJM_00090 [Helicobacter pylori SJM180]
MIILSASVKNLREISVKEKFLWLNAKSYLISVFAPFILLPWIDLLSAFLLYLGFLALFSVLEFFDEDIAD
IIVAKSKIKTKTKCYRA
 
Nucleotide Sequence: 264 bp     [Download]
>gi|308183796|ref|NC_014560.1|:14094-14357 Helicobacter pylori SJM180 chromosome, complete genome
ATGATTATCCTATCAGCGAGCGTGAAGAATTTGCGTGAAATTTCGGTTAAAGAAAAATTTTTATGGCTGA
ACGCCAAGTCTTATTTGATTTCTGTTTTTGCGCCTTTTATTTTGCTCCCTTGGATTGATTTATTGAGCGC
TTTTTTATTGTATTTAGGGTTTTTAGCGCTCTTTAGCGTGCTGGAATTTTTTGATGAAGACATTGCAGAT
ATTATCGTGGCTAAAAGCAAAATAAAGACTAAAACCAAATGTTATAGAGCGTAG
 Primer design