SecReT4
Protein ID: 308183815
T4SS name [ID]ComB [440]
Gene symbol-
Locus tagHPSJM_00095
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]14359..16722 [+]
Producthypothetical protein
Component typeComB4
UniProt IDE1Q0V3
KEGG IDhpm:HPSJM_00095
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.4e-55, Aligned region: 176..375
AAA_10 [PF12846], Evalue: 3.3e-24, Aligned region: 439..711
TrwB_AAD_bind [PF10412], Evalue: 2.3e-10, Aligned region: 438..502
TrwB_AAD_bind [PF10412], Evalue: 2.3e-10, Aligned region: 622..720
FtsK_SpoIIIE [PF01580], Evalue: 2.6e-06, Aligned region: 435..471
DUF87 [PF01935], Evalue: 1.6e-05, Aligned region: 438..483
TraG-D_C [PF12696], Evalue: 9.7e-05, Aligned region: 636..703
Protein Sequence: 787 a.a.     [Download]
>gi|308183815|ref|YP_003927948.1| hypothetical protein HPSJM_00095 [Helicobacter pylori SJM180]
MLEKFLGAIKQKVSNYFLGALPKSYSMSEENNILGLYDEHFLLTKNENLVGILRLEGVSYTHLSTEQLQD
LFTERQMALDSLEKVVARLVVKRRKIDYQQNIQSDSKHLQAILNQFENKEVYENRYFLVLESAHSLQGVL
EHKKKSLMHANRENFKDILSYKVHFLQETLKSLEIQLKNYAPKLLSSKEVLNFYAEYINGFDLPLKPLVG
GYLSDSYIASSITFEKDYFIQESFNQKTYNRLIGIKAYESERITSIAVGALLYQETPLDIIFSIEPMSVH
KTLSFLKERAKFSMSNLVKNELLEYQELVKTKRLSMQKFALNILIKAPSLEDLDAQTSLVLGLLFKENLV
GVIETFGLKGGYFSFFPERIHLNHRLRFLTSKALACLMVFERQNLGFKANSWGNSPLSVFKNLDYSPFLF
NFHNQEVSHNNAKEIARVNGHTLVIGATGSGKSTLISFLMMSALKYQNMRLLAFDRMQGLYSFTEFFKGH
YHDGQSFSINPFCLEPNLQNLEFLQSFFLSMFDLAPSRDKEALEDMNAISSAIKSLYETLYPKDFSLLDF
KETLKRTSSNQLSLSLEPYLNNPLFNALNDAFNSNAFLNVINLDTITQNPKDLGLLAYYLFYKILEESRK
NDSGFLVFLDEFKSYVENDLLNTKINALITQARKANGVVVLALQDIYQLSGVKNAHSFLSNMGTLILYPQ
KNARELKHHFNVPLSETEISFLENTPLYARQVLVKNLGNGSSNMIDVSLEGLGRYLKIFNSDSSHVNKVK
ALQKDYPTEWREKLLKS
 
Nucleotide Sequence: 2364 bp     [Download]
>gi|308183796|ref|NC_014560.1|:14359-16722 Helicobacter pylori SJM180 chromosome, complete genome
ATGTTAGAAAAGTTTTTAGGCGCTATCAAACAAAAAGTTTCAAATTATTTTTTAGGGGCTTTGCCTAAAA
GCTATTCTATGAGTGAAGAAAACAACATTTTAGGCTTGTATGATGAGCATTTTTTACTCACTAAAAACGA
AAACTTAGTGGGAATCCTCCGTTTAGAGGGGGTGAGTTACACCCATTTAAGCACAGAGCAATTGCAAGAT
CTTTTCACCGAGCGCCAAATGGCGTTGGATTCTTTGGAAAAAGTCGTGGCGCGCCTGGTGGTTAAAAGGC
GTAAAATTGATTATCAACAAAACATTCAATCTGATTCTAAACACTTGCAAGCGATCTTGAATCAGTTTGA
AAACAAAGAAGTGTATGAAAATCGGTATTTTTTGGTTTTAGAAAGCGCGCATTCCTTGCAGGGCGTTTTG
GAGCATAAGAAAAAATCTCTCATGCATGCCAATAGGGAAAATTTTAAGGATATTCTCTCTTATAAAGTGC
ATTTTTTGCAAGAAACTTTAAAAAGTTTAGAAATCCAGCTCAAAAATTATGCCCCCAAACTCTTAAGCTC
TAAAGAGGTTTTGAATTTTTACGCAGAATACATTAACGGGTTTGATCTCCCCCTAAAGCCCCTAGTAGGG
GGGTATTTGAGCGATAGCTATATCGCTAGTTCCATCACTTTTGAAAAAGATTATTTCATTCAAGAAAGCT
TCAATCAAAAAACCTACAACCGCTTGATTGGTATTAAAGCTTATGAGAGCGAGCGCATCACTTCTATAGC
GGTGGGAGCGCTTTTATACCAAGAAACGCCTTTAGATATCATCTTTTCTATAGAGCCTATGAGTGTGCAT
AAAACGCTGAGTTTTTTAAAAGAGAGAGCCAAATTTAGCATGTCTAATCTCGTTAAAAACGAGCTTTTAG
AATACCAAGAATTAGTCAAAACTAAACGATTATCCATGCAAAAATTCGCCCTAAACATTCTTATCAAAGC
CCCTAGTTTAGAGGATTTAGACGCTCAAACAAGCTTAGTTTTAGGGCTTTTATTTAAAGAAAACTTAGTG
GGCGTTATAGAAACTTTTGGCTTGAAAGGGGGGTATTTTTCCTTTTTCCCTGAACGCATCCATTTAAACC
ACCGCTTGCGTTTTTTAACCTCTAAAGCCCTAGCGTGTTTGATGGTGTTTGAAAGGCAAAATTTAGGTTT
TAAGGCTAATTCATGGGGGAATAGCCCTTTGAGCGTGTTTAAAAATTTGGATTATTCCCCTTTTTTATTC
AATTTCCACAACCAAGAAGTGAGCCACAATAACGCTAAAGAAATCGCCAGAGTGAATGGGCATACTTTAG
TTATAGGGGCAACCGGAAGCGGTAAAAGCACGCTGATTAGCTTTTTAATGATGAGCGCTTTGAAATACCA
AAACATGCGCCTTTTAGCCTTTGACAGGATGCAAGGGCTGTATTCTTTCACCGAATTTTTTAAAGGGCAT
TACCATGATGGCCAATCTTTTAGCATCAACCCCTTTTGTTTAGAGCCTAATTTACAGAATTTAGAATTTT
TGCAATCCTTCTTTTTGAGCATGTTTGATCTCGCCCCTTCAAGGGATAAAGAAGCCCTAGAAGACATGAA
TGCGATTTCTAGCGCGATTAAGAGCCTTTATGAGACTTTATACCCTAAAGATTTTAGTTTGCTAGACTTT
AAAGAAACGCTTAAAAGAACTTCATCTAACCAACTAAGCTTGAGCTTGGAGCCGTATTTGAATAACCCCC
TTTTTAACGCTTTGAATGACGCATTCAATTCCAACGCTTTTTTAAATGTGATAAACCTAGACACCATCAC
CCAAAACCCTAAAGACTTAGGGCTTTTAGCCTATTACTTGTTTTATAAAATTTTAGAAGAATCCAGGAAA
AACGACAGCGGTTTTTTGGTTTTTTTAGACGAGTTTAAATCCTATGTGGAAAACGATTTATTGAACACCA
AAATCAACGCTTTAATCACGCAAGCCAGAAAAGCTAATGGCGTGGTGGTGTTGGCTTTGCAAGACATTTA
CCAATTAAGCGGGGTTAAAAACGCCCATAGTTTTTTAAGCAACATGGGGACTCTCATTTTGTACCCGCAA
AAAAACGCTAGGGAGTTGAAACACCACTTCAATGTGCCTTTGAGCGAAACTGAAATTTCTTTTTTAGAAA
ACACCCCTTTGTATGCCAGACAGGTTTTAGTCAAAAATCTGGGTAACGGGAGTTCCAACATGATTGATGT
GAGTTTGGAGGGCTTGGGGCGTTATTTGAAAATCTTTAATTCAGATTCTAGCCATGTCAATAAAGTGAAA
GCGTTACAAAAAGACTACCCTACAGAGTGGCGTGAGAAACTTTTGAAGAGCTAG
 Primer design