SecReT4
Protein ID: 308183837
T4SS name [ID]ComB [440]
Gene symbol-
Locus tagHPSJM_00205
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]36562..37617 [+]
ProductNADH-ubiquinone oxidoreductase subunit
Component typeComB6
UniProt IDE1Q154
KEGG IDhpm:HPSJM_00205
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2e-07, Aligned region: 44..259
Protein Sequence: 351 a.a.     [Download]
>gi|308183837|ref|YP_003927970.1| NADH-ubiquinone oxidoreductase subunit [Helicobacter pylori SJM180]
MKHDAYEIILSWFITPLTAILGRFAEFFLYTLHAQLVFNSVVALAFMLFAYRSLKEQNFFSASVLTEALL
FVGFFALFNYALKNPMHFYEFFQNAIFIAPNMITQSLSQSLSNFSNHALSLDFIFNHGFYALSFISDLSH
NEMSVWLFLSILQGLFLSVLFAIIILVYLEVHVWCSLGALFLAFGFFKTWRSVVFICLKKCFALGFYKPF
LLLVGFLNVSVTKALMDASMQEKQDLSLLLVVALFLCCVFIIGVPFFINALFRVQNSLKETYKLATNLSA
NLSQNALSSLQYITTSPAPSSVSPSTSGSVSKEKETHSPTFKVETTQLDVKIPNFKQKKVKKDTINTKNE
I
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|308183796|ref|NC_014560.1|:36562-37617 Helicobacter pylori SJM180 chromosome, complete genome
ATGAAACATGACGCTTATGAGATTATCCTTTCTTGGTTTATCACGCCTCTCACGGCGATTTTAGGGCGTT
TCGCTGAATTTTTTCTCTACACCTTGCATGCGCAATTGGTGTTTAATAGCGTGGTCGCTTTGGCGTTCAT
GCTCTTTGCTTATAGGAGTTTGAAGGAACAGAACTTCTTCAGCGCCAGCGTGCTAACAGAAGCGTTATTG
TTTGTGGGGTTTTTTGCGCTTTTTAACTACGCTTTAAAAAATCCCATGCATTTTTATGAATTTTTCCAAA
ACGCTATTTTTATTGCGCCTAACATGATCACTCAAAGCCTCTCTCAAAGCTTGAGTAACTTTTCTAACCA
CGCACTTTCTTTAGATTTTATCTTTAATCATGGTTTTTATGCCCTTAGCTTCATCAGCGATTTGAGCCAT
AATGAAATGTCTGTGTGGCTTTTTTTAAGTATTTTGCAAGGGCTTTTTTTGAGCGTGCTGTTTGCGATCA
TCATTTTAGTGTATTTAGAAGTGCATGTGTGGTGCTCTTTAGGGGCGCTGTTTTTAGCGTTTGGGTTTTT
TAAAACCTGGAGGAGCGTTGTGTTTATATGCCTAAAAAAATGCTTCGCTCTTGGGTTTTACAAGCCTTTT
TTGTTGTTGGTGGGGTTTTTGAATGTTTCAGTTACTAAGGCGTTAATGGATGCTAGCATGCAAGAAAAAC
AAGACTTAAGCCTTTTATTAGTGGTAGCGTTATTTTTGTGTTGCGTTTTTATCATAGGCGTGCCTTTTTT
CATCAACGCTTTGTTTAGGGTGCAAAACAGCCTTAAAGAAACTTACAAACTCGCCACCAATTTGAGCGCC
AACCTCAGCCAAAACGCCCTTAGTTCCTTACAATATATCACGACCTCGCCCGCTCCCTCTAGCGTTTCTC
CTTCTACAAGCGGAAGCGTTTCTAAAGAAAAAGAAACGCATTCCCCCACATTTAAGGTAGAAACCACTCA
ATTAGATGTAAAAATCCCAAATTTCAAGCAAAAAAAGGTTAAAAAGGATACAATAAATACAAAAAATGAA
ATTTAA
 Primer design