SecReT4
Protein ID: 308183838
T4SS name [ID]ComB [440]
Gene symbol-
Locus tagHPSJM_00210
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]37633..37746 [+]
ProductComb7 competence protein
Component typeComB7
UniProt IDE1Q155
KEGG IDhpm:HPSJM_00210
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 37 a.a.     [Download]
>gi|308183838|ref|YP_003927971.1| Comb7 competence protein [Helicobacter pylori SJM180]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA
 
Nucleotide Sequence: 114 bp     [Download]
>gi|308183796|ref|NC_014560.1|:37633-37746 Helicobacter pylori SJM180 chromosome, complete genome
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAA
AAAGCCCTTGCACCTTGTATGAAAACAGGTTAAATCTCGCATGA
 Primer design