SecReT4
Protein ID: 308183839
T4SS name [ID]ComB [440]
Gene symbol-
Locus tagHPSJM_00215
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]37743..38486 [+]
ProductcomB8 competence protein
Component typeComB8
UniProt IDE1Q156
KEGG IDhpm:HPSJM_00215
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.3e-32, Aligned region: 41..239
Protein Sequence: 247 a.a.     [Download]
>gi|308183839|ref|YP_003927972.1| comB8 competence protein [Helicobacter pylori SJM180]
MREKPFNSEQLIYLEELLSHQEKHLENKLSGFSVNDLDMQSVFRLERNRLKIAYKLLGLMSFIALVLAIV
LISVLPLQKTEHHFVDFLNQDKHYAIIQRADKSISSNEALARSLIGAYVLNRESINRIDDKSRYELVRLQ
SSSKVWQRFEDLIKTQNSIYAQSHLEREVHIVNIAIYQQDNNPIASVSIAAKLMNENKLVYEKRYKIVLS
YLFDTPDFDYASMPKNPTGFKITRYSITEIAPTNRGD
 
Nucleotide Sequence: 744 bp     [Download]
>gi|308183796|ref|NC_014560.1|:37743-38486 Helicobacter pylori SJM180 chromosome, complete genome
ATGAGAGAAAAGCCTTTCAACAGCGAGCAGTTGATTTATTTAGAAGAGCTTTTAAGCCACCAAGAAAAGC
ATTTAGAAAACAAGCTTTCTGGTTTTTCGGTGAATGATTTGGACATGCAAAGCGTGTTTCGGTTGGAAAG
GAACCGCTTGAAAATCGCTTATAAACTCTTAGGCTTGATGAGTTTTATCGCTCTTGTTTTAGCGATCGTG
TTAATCAGTGTTCTACCCTTACAAAAAACCGAACACCATTTCGTGGATTTTTTAAACCAAGACAAGCATT
ACGCCATTATCCAAAGAGCGGATAAAAGCATTTCCAGTAATGAAGCGTTGGCTCGTTCGCTCATTGGGGC
GTATGTGTTAAACCGAGAGAGCATTAACCGCATTGACGATAAATCGCGCTATGAATTGGTGCGCTTGCAA
AGCAGTTCTAAAGTGTGGCAACGCTTTGAAGATTTGATTAAAACGCAAAACAGCATCTATGCGCAAAGCC
ATTTAGAAAGAGAGGTCCATATCGTCAATATTGCGATCTATCAGCAAGACAATAACCCCATTGCGAGCGT
CTCTATTGCGGCTAAACTCATGAACGAAAACAAGCTGGTGTATGAAAAGCGTTATAAAATCGTATTGAGC
TATTTGTTTGACACCCCGGATTTTGATTACGCTTCCATGCCTAAAAACCCTACCGGCTTTAAAATCACCC
GCTACAGCATCACTGAAATCGCGCCGACTAACAGGGGCGATTGA
 Primer design