SecReT4
Protein ID: 308183840
T4SS name [ID]ComB [440]
Gene symbol-
Locus tagHPSJM_00220
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]38486..39466 [+]
ProductComB9 competence protein
Component typeComB9
UniProt IDE1Q157
KEGG IDhpm:HPSJM_00220
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-26, Aligned region: 62..318
Protein Sequence: 326 a.a.     [Download]
>gi|308183840|ref|YP_003927973.1| ComB9 competence protein [Helicobacter pylori SJM180]
MRKILYALMGFLLAFSALKADDFLEEANETAPAHLNHPMQDLNAIQGSFFDKNRSKMSNTLNIDYFQGQT
YKIRLRYAMATLLFFSKPISDFVLGDKVGFDAKILESNDRILLIKPLQIGVDSNISVIDSEGKIFSFYVF
STTFTSSKHPNLQVFIEDKNYYSNAFLKPQNKENVLENTLENAPTNNKPLKEEKEETKEKEEETITIGDN
TNAMKIIKKDIQKGYKALKSSQRKWYCLGICSKKSKLSLMPKEIFNDKQFTYFKFDKRLALSKFPVIYKV
VDGYDNPVNTRIVGDYIIAEDVSAKWTLRLGKDYLCIRFVKKAKDE
 
Nucleotide Sequence: 981 bp     [Download]
>gi|308183796|ref|NC_014560.1|:38486-39466 Helicobacter pylori SJM180 chromosome, complete genome
ATGCGTAAGATTTTATATGCCCTCATGGGCTTTTTGTTGGCTTTTAGTGCTTTAAAAGCCGATGATTTTT
TAGAAGAAGCGAACGAAACAGCCCCGGCGCATTTAAACCACCCCATGCAGGATTTAAACGCCATTCAAGG
GAGCTTTTTTGATAAAAACCGCTCAAAAATGTCCAACACTTTGAACATTGATTACTTTCAAGGGCAAACC
TATAAAATCCGCTTGCGTTATGCGATGGCGACCTTATTGTTTTTTTCAAAACCCATTAGCGATTTTGTTT
TAGGGGATAAGGTGGGTTTTGATGCGAAAATCTTAGAAAGTAACGATCGCATTTTGCTCATCAAACCCCT
ACAAATTGGCGTGGATTCTAATATCAGCGTGATTGATAGTGAAGGTAAGATTTTTTCTTTCTATGTGTTT
TCTACCACTTTCACCAGCTCCAAACACCCTAATTTACAGGTTTTCATAGAAGATAAAAACTATTATTCTA
ACGCTTTTTTGAAGCCGCAAAATAAAGAAAATGTCCTTGAAAATACCCTTGAAAATGCCCCCACAAACAA
CAAACCCTTAAAAGAAGAAAAAGAAGAAACCAAAGAAAAAGAAGAAGAGACTATAACTATTGGCGATAAC
ACTAATGCGATGAAAATTATTAAAAAAGACATTCAAAAAGGTTATAAGGCTTTAAAAAGCTCTCAAAGGA
AATGGTATTGTTTAGGGATTTGTTCTAAAAAATCCAAACTCTCTTTGATGCCTAAAGAAATCTTTAACGA
CAAGCAATTCACTTATTTCAAATTTGACAAAAGATTAGCGCTCTCTAAATTCCCGGTGATTTATAAGGTC
GTTGATGGCTATGATAACCCGGTGAATACAAGGATTGTAGGCGATTACATTATCGCTGAAGACGTTTCGG
CTAAATGGACTTTAAGGCTGGGTAAGGACTATTTGTGCATCCGTTTTGTCAAAAAGGCTAAAGATGAATA
A
 Primer design