SecReT4
Protein ID: 308183841
T4SS name [ID]ComB [440]
Gene symbol-
Locus tagHPSJM_00225
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]39459..40595 [+]
ProductComB10 competence protein
Component typeComB10
UniProt IDE1Q158
KEGG IDhpm:HPSJM_00225
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.2e-47, Aligned region: 173..364
Protein Sequence: 378 a.a.     [Download]
>gi|308183841|ref|YP_003927974.1| ComB10 competence protein [Helicobacter pylori SJM180]
MNKWLKGAIVFVGGFATITTISLVYHQKPKAPLNNQPSLLNDDEVKYPLQDYTFTQNPQPTNTESSKDAT
IKALQEQLKAALKALNSKEMNHSKEETFTSPPIDLKTNTTPPKKDFSPKQLDLLAARITPFKQSPKNYEE
NLIFPVDNPNGIDGFTNLKEKDIATNENKLLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGK
AVLIPKGSKVIGYYSNNNKMGEYRLDIVWSRIITPHGINIMLTNAKGADIKGYNGLVGELIERNFQRYGV
PLLLSTLTNGLLIGITSALNNRGNKEGATNFFGDYLLLQLMRQSGMGINQVVNQILRDKSKIAPIVVIRE
GSRVFISPNTDIFFPIPRENEVIAEFLK
 
Nucleotide Sequence: 1137 bp     [Download]
>gi|308183796|ref|NC_014560.1|:39459-40595 Helicobacter pylori SJM180 chromosome, complete genome
ATGAATAAGTGGCTTAAGGGGGCGATTGTTTTTGTAGGGGGTTTTGCAACGATTACAACCATTTCTTTAG
TCTATCATCAAAAGCCAAAAGCCCCCTTAAATAACCAGCCTAGCCTTTTAAATGACGATGAGGTGAAATA
CCCCTTACAAGACTACACCTTCACTCAAAACCCACAGCCAACTAACACAGAAAGCTCCAAAGACGCTACT
ATTAAAGCCTTACAAGAACAGCTCAAAGCCGCTTTAAAAGCCCTAAACTCCAAAGAAATGAACCATTCCA
AAGAAGAAACTTTTACCAGTCCTCCCATAGATTTAAAAACAAACACAACCCCCCCTAAAAAAGATTTTTC
TCCAAAGCAATTAGATTTATTAGCCGCTCGCATCACCCCTTTCAAACAAAGCCCTAAAAATTACGAAGAA
AACCTGATTTTTCCTGTGGATAACCCTAATGGCATTGATGGTTTCACTAACCTTAAAGAAAAAGACATTG
CCACTAATGAAAACAAGCTTTTACGCACCATTACAGCCGATAAAATGATACCCGCTTTTTTGATCACGCC
CATTTCTAGCCAGATCGCTGGTAAAGTGATTGCGCAAGTGGAAAGCGATATTTTCGCTCACATGGGCAAG
GCTGTTTTAATCCCCAAAGGCTCTAAAGTCATAGGCTATTACAGCAACAATAACAAAATGGGCGAATACC
GCTTGGATATTGTATGGAGTCGCATCATCACTCCCCATGGCATCAATATCATGCTCACTAACGCTAAAGG
GGCGGACATTAAAGGCTATAACGGCTTAGTGGGGGAATTGATTGAAAGGAATTTCCAGCGCTATGGCGTG
CCGTTACTGCTTTCTACGCTCACTAACGGCTTATTGATTGGGATCACTTCGGCTTTAAACAACAGAGGCA
ATAAAGAAGGAGCCACCAATTTCTTTGGGGATTATCTTTTATTGCAATTGATGAGGCAAAGTGGCATGGG
GATCAATCAAGTGGTCAATCAAATTTTAAGAGACAAGAGCAAGATCGCCCCCATTGTGGTGATTAGAGAG
GGGAGTAGGGTCTTCATTTCGCCCAATACTGACATCTTCTTCCCTATACCCAGAGAGAATGAAGTCATCG
CTGAGTTTTTGAAGTGA
 Primer design