SecReT4
Protein ID: 308184293
T4SS name [ID]Cag [32]
Gene symbol-
Locus tagHPSJM_02565
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]506517..507167 [+]
Productcag pathogenicity island protein D
Component typeCagD
UniProt IDE1PYW8
KEGG IDhpm:HPSJM_02565
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 216 a.a.     [Download]
>gi|308184293|ref|YP_003928426.1| cag pathogenicity island protein D [Helicobacter pylori SJM180]
MAKVEELAKLINNNSNKKLRGFFLKVLLSLVVFSLYGLANDDNQAKKEALEKEKNTPNGLVYTNLDFDSF
KATIKNLKDKKVTFKEVNPDIIKDEVFDFVIVNRVLKKIKDLKHYDPIIEKIFDEKGKEMGLNVELQINP
EVKDFFTFKSISTTNKQRCFLSLRGETREILCDDKLYNVLLAVFNSYDPNDLLKHISTVESLKKIFYTIT
CEAVYL
 
Nucleotide Sequence: 651 bp     [Download]
>gi|308183796|ref|NC_014560.1|:506517-507167 Helicobacter pylori SJM180 chromosome, complete genome
TTGGCGAAAGTGGAGGAGCTAGCTAAATTGATCAATAATAATAGTAATAAAAAACTGAGAGGCTTTTTTT
TGAAAGTTCTCTTAAGTCTCGTTGTTTTCAGTTTGTATGGGTTAGCAAATGATGATAATCAAGCCAAAAA
AGAAGCGCTAGAAAAAGAAAAAAACACTCCCAATGGGCTTGTTTATACGAATTTAGATTTTGATAGTTTC
AAAGCGACTATCAAAAATTTGAAAGACAAGAAAGTAACTTTCAAAGAAGTCAATCCCGATATTATCAAAG
ATGAAGTTTTTGATTTCGTGATTGTCAATAGAGTCCTTAAAAAAATAAAGGATTTGAAGCATTACGATCC
CATTATTGAAAAAATCTTTGATGAAAAGGGTAAAGAAATGGGACTGAATGTAGAATTACAGATCAATCCT
GAAGTGAAAGACTTTTTTACTTTCAAAAGCATCAGCACGACCAACAAACAACGCTGCTTTCTGTCATTGC
GCGGGGAAACAAGAGAAATTTTATGCGATGATAAGCTATATAATGTTTTATTGGCCGTATTCAATTCTTA
TGACCCTAATGATCTTTTGAAACACATTAGCACCGTAGAGTCTCTCAAAAAAATCTTTTATACGATTACA
TGTGAAGCGGTATATCTATAA
 Primer design