SecReT4
Protein ID: 308184296
T4SS name [ID]Cag [32]
Gene symbol-
Locus tagHPSJM_02580
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]510990..511418 [+]
Productcag pathogenicity island protein (cag21)
Component typeCagG
UniProt IDE1PYX1
KEGG IDhpm:HPSJM_02580
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|308184296|ref|YP_003928429.1| cag pathogenicity island protein (cag21) [Helicobacter pylori SJM180]
MKTNFYKIKLLFAWCLIIGMFNAPLNADQNTDIKDISPEDMALNSVGLVSRDQLKIEIPKETLEQKVAIL
NDYNDKNVNIKFDNISLGSFQPNDNLGINAMWGIQNLLMSQMMGDYGPNNPFMYGYAPTYSDSSFLPPIL
GY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|308183796|ref|NC_014560.1|:510990-511418 Helicobacter pylori SJM180 chromosome, complete genome
ATGAAAACGAATTTTTATAAAATTAAATTACTATTTGCTTGGTGTCTTATCATTGGCATGTTTAACGCTC
CGCTTAACGCTGACCAAAACACGGATATAAAAGATATTAGTCCTGAAGATATGGCGCTAAATAGCGTGGG
GCTTGTTTCTAGAGATCAGCTAAAAATAGAGATCCCTAAAGAAACCCTAGAGCAAAAAGTGGCCATACTC
AATGACTATAATGATAAGAATGTTAATATCAAGTTTGATAACATAAGTTTAGGGAGTTTTCAACCTAATG
ATAATCTAGGTATCAATGCGATGTGGGGCATTCAAAATCTTCTCATGAGCCAAATGATGGGCGATTACGG
TCCAAACAATCCTTTCATGTATGGCTATGCGCCAACATACTCAGATTCATCGTTTTTACCACCGATCTTA
GGGTATTAA
 Primer design