SecReT4
Protein ID: 308184300
T4SS name [ID]Cag [32]
Gene symbol-
Locus tagHPSJM_02600
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]513700..514413 [+]
Productcag pathogenicity island protein L
Component typeCagL
UniProt IDE1PYX5
KEGG IDhpm:HPSJM_02600
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|308184300|ref|YP_003928433.1| cag pathogenicity island protein L [Helicobacter pylori SJM180]
MKTLVKNTISSFLLLSVLMAEDITSGLKQLDSTYQETNQQVLKNLDEIFSTTSPSANDKMGEEDALNIKK
AAIALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINPLDQKTAEQQCGISDKILVLYCE
GKLKIEQEKQNIRERLETSLKAYQSNIGGTASLIIASQTLVESLKNKNFIKGIRKLMLAHNKVFLNYLEE
LDALERSLEQSKRQYLQERQSSKIIVK
 
Nucleotide Sequence: 714 bp     [Download]
>gi|308183796|ref|NC_014560.1|:513700-514413 Helicobacter pylori SJM180 chromosome, complete genome
ATGAAAACACTCGTGAAAAATACCATATCTTCTTTTTTGCTATTGTCTGTTTTGATGGCAGAAGATATAA
CAAGCGGCTTAAAGCAACTGGATAGCACCTACCAAGAGACCAACCAACAAGTACTCAAAAACTTAGATGA
AATTTTTTCAACCACTAGCCCTAGCGCTAATGATAAAATGGGTGAAGAAGATGCTCTAAACATCAAAAAA
GCAGCCATTGCTTTGAGAGGAGATTTAGCGTTATTGAAAGCCAATTTTGAAGCGAATGAGTTATTTTTCA
TCTCAGAAGATGTGATTTTTAAGACTTATATGTCTAGCCCTGAACTTTTATTAACCTATATGAAAATCAA
TCCCTTAGACCAAAAGACTGCTGAACAGCAATGCGGAATATCCGATAAAATTTTAGTTCTTTATTGTGAG
GGGAAGCTGAAAATCGAGCAAGAAAAACAAAATATAAGAGAGCGTTTAGAAACTTCTCTAAAGGCGTATC
AGAGCAACATTGGAGGTACAGCTTCTTTAATCATTGCTTCACAGACGCTTGTAGAAAGCCTAAAGAATAA
AAATTTCATCAAAGGAATCAGAAAGCTTATGTTAGCTCATAACAAGGTCTTTTTAAATTATTTAGAGGAG
TTGGACGCATTAGAAAGATCCCTAGAACAAAGCAAGCGACAATACCTACAAGAAAGGCAATCAAGTAAGA
TCATTGTTAAATGA
 Primer design