SecReT4
Protein ID: 308184301
T4SS name [ID]Cag [32]
Gene symbol-
Locus tagHPSJM_02605
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]514495..515415 [-]
Productcag island protein
Component typeCagN
UniProt IDE1PYX6
KEGG IDhpm:HPSJM_02605
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 306 a.a.     [Download]
>gi|308184301|ref|YP_003928434.1| cag island protein [Helicobacter pylori SJM180]
MKSIFKKLGSVALYSLVIYGGLNAINTALLPSEYKELVALGFKKIKTLYQRHDDKEITKEEKEFATNALR
EKLRNDRARAEQIQKNIEAFEKKNNSSVQKKATKHRGLQELNEINANPLNDNPNGNSSTETKSNKDDNFD
EMINKVNESFVKPAAPLVPDEWRTPEIEIIINECIISSNDYDGLRKCLIKGIKDQKILAPLLEKIQEIET
ENNKFSRQHLSGLKLALNNSNNRTFLIASCAICEKRKKEMEQENNYQDTTNASEFGTTDTKENEAKDATF
SNNRSKSELPNSVINQIEQSIAHGKK
 
Nucleotide Sequence: 921 bp     [Download]
>gi|308183796|ref|NC_014560.1|:c515415-514495 Helicobacter pylori SJM180 chromosome, complete genome
TTGAAAAGTATCTTCAAAAAATTAGGTTCTGTCGCTCTTTATTCTTTGGTTATTTATGGGGGCTTAAACG
CTATCAATACAGCATTATTACCGAGTGAATACAAAGAATTGGTGGCTTTAGGCTTTAAAAAAATCAAAAC
ACTCTATCAAAGACATGACGACAAAGAAATTACAAAAGAGGAAAAAGAATTCGCCACTAACGCTTTGAGA
GAAAAATTACGGAATGATAGGGCGAGAGCAGAGCAAATTCAAAAGAATATTGAAGCGTTTGAAAAAAAGA
ACAACTCTTCTGTTCAAAAAAAAGCGACTAAGCACAGAGGATTGCAAGAATTAAACGAAATTAACGCTAA
CCCTTTGAATGACAACCCTAATGGCAATTCTTCCACTGAAACCAAATCTAATAAAGATGATAACTTTGAT
GAGATGATCAATAAGGTGAATGAATCTTTTGTGAAACCTGCTGCTCCGCTTGTGCCTGATGAGTGGAGAA
CACCTGAAATTGAAATCATTATCAATGAGTGTATTATTTCAAGCAACGATTACGATGGGTTAAGAAAGTG
TTTGATCAAAGGAATCAAGGATCAAAAAATTCTTGCCCCCTTATTAGAAAAAATTCAAGAAATAGAGACA
GAAAATAACAAGTTTTCTAGACAACACTTGAGTGGTTTAAAACTCGCTCTTAATAACAGCAACAATAGAA
CCTTTCTTATAGCTTCGTGCGCTATTTGTGAGAAGAGAAAGAAAGAAATGGAGCAAGAAAATAACTACCA
AGATACTACAAATGCAAGTGAGTTTGGCACTACTGATACAAAAGAAAATGAAGCAAAAGATGCAACATTC
TCAAACAATCGCTCTAAATCTGAACTGCCCAATAGCGTCATTAATCAAATAGAACAAAGTATCGCTCATG
GAAAAAAATAG
 Primer design