SecReT4
Protein ID: 308184302
T4SS name [ID]Cag [32]
Gene symbol-
Locus tagHPSJM_02610
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]515430..516560 [-]
Productcag island protein
Component typeCagM
UniProt IDE1PYX7
KEGG IDhpm:HPSJM_02610
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 376 a.a.     [Download]
>gi|308184302|ref|YP_003928435.1| cag island protein [Helicobacter pylori SJM180]
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLEDLVFRKQKIKE
LVDYRAKVLLDLENKYKKEKEALEKETRGKILTAKSKAYGDLEQALKDNPLYKKLLPNPYAYVLNQETFT
QEDKERLSYYYPQVKTSSIFKKTTATTKDKAQALLQMGVFSLDEEQNKKASRLALSYKQAIEEYSNNISN
LLSRKELDNIDYYLQLERNKFDSKAKDIAQKATNTLIFNSERLAFSMAIDKINEKYLRGYEAFSNLLKNV
KDDVELNTLTKNFTNQKLSFAQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKE
HYKIFNFFKTVVSAYRNNVAKNNPFE
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|308183796|ref|NC_014560.1|:c516560-515430 Helicobacter pylori SJM180 chromosome, complete genome
ATGCTTGCAAAAATCGTTTTTAGCTCGTTGGTTGCGTTTGGAGTTTTGTCGGCTAATGTGGAGCAGTTTG
GTTCATTTTTCAACGAGATAAAAAAAGAACAAGAAGAAGTGGCTGCAAAAGAAGACGCTCTTAAGGCTCG
TAAGAAGCTCTTAAACAATACGCATGATTTCTTAGAAGACTTGGTTTTTAGAAAACAAAAAATCAAAGAG
CTTGTGGATTACAGAGCTAAAGTTCTTTTAGATTTAGAAAACAAATACAAAAAAGAAAAAGAGGCTCTAG
AGAAAGAGACAAGAGGTAAAATCCTTACTGCTAAGTCAAAGGCTTATGGGGATCTAGAGCAAGCCTTAAA
AGATAACCCTCTCTATAAGAAACTTCTTCCTAACCCTTATGCCTATGTTTTAAACCAAGAAACATTCACG
CAAGAGGATAAGGAGCGTTTGAGTTATTACTACCCCCAAGTGAAAACGAGCAGTATTTTTAAAAAAACTA
CCGCTACCACTAAAGATAAGGCTCAGGCTTTGCTTCAAATGGGTGTGTTTTCTTTAGATGAAGAACAAAA
CAAAAAAGCGAGCCGATTAGCTTTATCTTACAAGCAAGCGATTGAAGAATATTCCAATAACATTTCTAAT
TTATTGAGCAGAAAAGAATTGGATAATATAGATTATTACTTGCAGCTTGAAAGAAACAAATTTGACTCCA
AAGCAAAAGATATTGCCCAAAAAGCTACTAACACGCTTATTTTTAACTCGGAACGCTTGGCGTTTAGCAT
GGCGATTGATAAGATCAATGAGAAATACTTAAGGGGCTATGAGGCTTTTTCTAACTTGTTGAAAAATGTC
AAAGATGATGTGGAATTGAATACTTTGACTAAAAACTTCACCAACCAAAAATTGAGTTTCGCTCAAAAAC
AAAAATTGTGTTTGTTGGTTTTAGACAGCTTCAATTTTGATACCCAATCCAAAAAATCTATATTAAAAAA
GACTAATGAATACAATATCTTCGTAGATAGCGATCCTATGATGAGCGACAAAACAACTATGCAAAAAGAA
CACTACAAGATATTTAATTTCTTTAAAACAGTGGTTTCTGCATACCGGAACAATGTTGCCAAGAATAACC
CCTTTGAATAG
 Primer design