SecReT4
Protein ID: 308184305
T4SS name [ID]Cag [32]
Gene symbol-
Locus tagHPSJM_02625
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]519383..520225 [-]
ProductCAG pathogenicity island protein 12
Component typeCagT
UniProt IDE1PYY0
KEGG IDhpm:HPSJM_02625
PDB IDNA
Domain hit(s) vs Pfam Cag12 [PF13117], Evalue: 7e-36, Aligned region: 13..123
Protein Sequence: 280 a.a.     [Download]
>gi|308184305|ref|YP_003928438.1| CAG pathogenicity island protein 12 [Helicobacter pylori SJM180]
MKLRASVLIGATILCLILSACSNYAKKVVKQKNHVYTPVYNELIEKYSEIPLNDKLKDTPFMVQVKLPNY
KDYLLDNKQVVLTFKLVHHSKKITLIGDANKILQYKNYFQANGARSDIDFYLQPTLNQKGVVMIASNYND
NPNSKEKPQTFDVLQGSQPMLGANTKNLHGYDVSGANNKQVINEVAREKAQLEKINQYYKTLLQDKEQEY
TTRKNNQREILETLSNRAGYQMRQNVISSEIFKNGNLNMQAREEEVREKLQEERENEYLRNQIRSLLSGK
 
Nucleotide Sequence: 843 bp     [Download]
>gi|308183796|ref|NC_014560.1|:c520225-519383 Helicobacter pylori SJM180 chromosome, complete genome
ATGAAACTGAGAGCAAGTGTTTTAATCGGTGCGACAATTCTGTGCTTAATTTTAAGCGCGTGCAGTAACT
ATGCGAAAAAAGTGGTGAAACAAAAGAACCATGTTTATACGCCTGTGTATAATGAACTGATAGAAAAGTA
TAGTGAGATACCCTTAAATGACAAGCTCAAAGACACACCATTCATGGTGCAAGTGAAGTTGCCAAATTAC
AAGGACTATTTGTTGGATAATAAACAAGTTGTACTAACTTTCAAACTTGTTCATCATTCTAAAAAGATTA
CGCTCATAGGCGATGCCAATAAGATCCTTCAATACAAGAATTACTTCCAAGCTAACGGGGCAAGATCCGA
CATTGATTTTTACTTGCAACCCACTTTGAATCAAAAGGGTGTGGTGATGATAGCGAGTAACTACAATGAT
AATCCTAACAGCAAAGAAAAACCACAGACCTTTGATGTGTTGCAAGGAAGTCAGCCAATGCTAGGAGCTA
ACACAAAAAACTTGCATGGCTATGATGTGAGTGGAGCAAACAACAAGCAAGTGATCAATGAAGTGGCAAG
AGAAAAAGCCCAGCTGGAAAAAATCAATCAGTATTACAAAACTCTCTTGCAAGACAAGGAACAAGAATAT
ACCACTAGGAAAAATAACCAACGAGAAATTTTAGAAACCTTGAGTAATCGTGCAGGTTATCAAATGAGAC
AGAATGTGATTAGTTCTGAGATTTTTAAGAATGGCAACTTGAACATGCAAGCCAGAGAGGAAGAAGTTAG
GGAGAAGCTGCAAGAAGAAAGAGAGAATGAATACTTACGCAATCAAATCAGAAGTTTGCTCAGTGGTAAG
TGA
 Primer design