SecReT4
Protein ID: 308184307
T4SS name [ID]Cag [32]
Gene symbol-
Locus tagHPSJM_02635
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]521298..522056 [+]
Productcag pathogenicity island protein V
Component typeCagV
UniProt IDE1PYY2
KEGG IDhpm:HPSJM_02635
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.8e-21, Aligned region: 23..225
Protein Sequence: 252 a.a.     [Download]
>gi|308184307|ref|YP_003928440.1| cag pathogenicity island protein V [Helicobacter pylori SJM180]
MLGKKNEEVLIDENLVGGVIALDRLAKLNKANRTFKRAFYLSMALNVAAVTSIVMMMPLKKTDIFVYGID
RYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQLMQYCDVSFQTQAMRMFNENI
RQFVDKVRAEAIISSNIQREKVKNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGNSSQENL
IINPFGFKVFDIQITDLQNEQTVSEILRKIKEVESKNKALNK
 
Nucleotide Sequence: 759 bp     [Download]
>gi|308183796|ref|NC_014560.1|:521298-522056 Helicobacter pylori SJM180 chromosome, complete genome
ATGTTAGGGAAAAAAAACGAAGAAGTCTTGATTGATGAAAATTTGGTTGGGGGTGTGATAGCCCTTGATA
GATTGGCAAAACTCAATAAGGCCAATAGGACTTTCAAAAGGGCTTTTTATCTCTCTATGGCACTCAATGT
CGCCGCTGTAACGAGTATTGTGATGATGATGCCTTTGAAGAAAACGGATATATTTGTTTATGGCATTGAT
CGATATACAGGAGAATTTAAAATTGTCAAACGCTCCGATGCTAGGCAAATTGTCAATTCTGAAGCTGTTG
TGGATAGTGCAACTTCAAAATTTGTTTCATTGCTGTTTGGTTATAGTAAAAATTCTTTGAGGGATCGCAA
GGATCAACTGATGCAATATTGCGATGTGAGTTTCCAAACCCAAGCAATGAGAATGTTCAATGAAAATATC
AGACAATTCGTGGATAAAGTCCGAGCAGAAGCTATCATTAGCTCTAACATACAAAGAGAAAAAGTCAAAA
ATAGTCCCTTAACGAGATTAACATTTTTTATTACCATCAAAATCACACCGGATACAATGGAAAATTATGA
ATATATTACTAAAAAACAAGTAACTATTTATTATGATTTTGCTAGAGGTAACTCTTCTCAAGAAAATCTT
ATCATCAATCCTTTTGGCTTCAAAGTGTTTGACATTCAAATCACGGATTTACAAAACGAACAGACAGTAA
GCGAAATTTTGAGAAAGATTAAAGAAGTGGAATCAAAAAATAAGGCATTAAATAAGTAA
 Primer design