SecReT4
Protein ID: 308184309
T4SS name [ID]Cag [32]
Gene symbol-
Locus tagHPSJM_02645
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]523721..525286 [+]
Productcag pathogenicity island protein X
Component typeCagX
UniProt IDE1PYY4
KEGG IDhpm:HPSJM_02645
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.9e-38, Aligned region: 54..170
CagX [PF03524], Evalue: 1.9e-38, Aligned region: 256..346
CagX [PF03524], Evalue: 1.9e-38, Aligned region: 367..489
Protein Sequence: 521 a.a.     [Download]
>gi|308184309|ref|YP_003928442.1| cag pathogenicity island protein X [Helicobacter pylori SJM180]
MGQAFFKKIVNCFCLGYLFLSSVIEAAPDIKNFNRGRVKVVNKKIAYLGDEKPITIWTSLDNVTVIQLEK
DETISYITTGFNKGWNIVPNSNHIFIQPKSVKSNLMFEKEAVNFALMTRDYQEFLKTKKLIVDAPDPKEL
EEQKKALEKEKEAKEQAQKAQKDKREKRKEERAKNRANLENLTNAMSNPQNLSNNKNLSELIKQQRENEL
DQMERLEDMQEQAQANALKQIEELNKKQAEETIKQRAKDKISIKTDKSQKSPEDNSIELSPSDSAWRTNL
VVRTNKALYQFILRIAQKDNFASAYLTVKLEYPQRHEVSSVIEEELKKREEAKRQKELIKQENLNTTAYI
NRVMMASNEQIINKEKIREEKQKIILDQAKALETQYVHNALKRNPVPRNYNYYQAPEKRSKHIMPSEIFD
DGTFTYFGFKNITLQPAIFVVQPDGKLSMTDAAIDPNMTNSGLRWYRVNEIAEKFKLIKDKALVTVINKG
YGKNPLTKNYNIKNYGELERVIKKLPLVRDK
 
Nucleotide Sequence: 1566 bp     [Download]
>gi|308183796|ref|NC_014560.1|:523721-525286 Helicobacter pylori SJM180 chromosome, complete genome
ATGGGGCAGGCATTTTTTAAAAAAATTGTTAACTGTTTCTGTCTTGGTTATTTATTTTTATCTAGCGTAA
TAGAAGCAGCACCTGACATTAAAAATTTTAATCGTGGCAGGGTGAAAGTGGTGAATAAGAAGATCGCTTA
TTTGGGAGATGAAAAACCCATCACGATTTGGACTTCATTAGACAATGTTACTGTGATCCAACTTGAAAAA
GATGAAACTATTTCTTACATCACAACAGGTTTCAATAAAGGTTGGAATATTGTGCCTAATTCTAATCATA
TATTCATTCAACCTAAATCGGTAAAAAGTAATCTCATGTTTGAAAAAGAAGCAGTGAATTTTGCCCTAAT
GACAAGAGATTACCAAGAATTTTTAAAAACAAAAAAACTTATCGTAGATGCACCTGACCCTAAAGAATTA
GAAGAACAAAAAAAAGCTCTAGAAAAAGAAAAAGAAGCTAAAGAACAAGCACAAAAAGCGCAAAAAGATA
AAAGAGAAAAAAGAAAAGAAGAGCGTGCAAAAAATAGAGCCAATTTAGAAAATCTCACTAACGCTATGAG
TAACCCACAAAATTTGAGCAATAACAAAAATCTTAGCGAACTTATCAAGCAACAACGAGAAAATGAATTA
GACCAAATGGAACGACTAGAGGACATGCAAGAACAGGCTCAAGCTAATGCGCTCAAACAAATTGAAGAAC
TCAACAAGAAACAAGCTGAAGAGACAATCAAGCAAAGAGCCAAAGATAAAATCAGTATTAAGACAGATAA
ATCTCAAAAAAGCCCCGAGGATAACTCCATAGAATTATCTCCTAGCGATAGCGCTTGGAGGACTAATCTT
GTTGTGCGGACCAATAAAGCCTTGTATCAATTCATTTTGAGGATAGCTCAAAAAGACAATTTTGCTTCAG
CGTATCTAACGGTCAAATTGGAATACCCACAAAGACACGAAGTTTCTAGCGTTATTGAAGAGGAATTAAA
AAAGAGAGAAGAAGCAAAGAGGCAGAAAGAATTGATCAAGCAAGAAAATCTCAACACCACAGCCTACATC
AATAGAGTAATGATGGCGAGCAATGAACAGATTATCAACAAAGAAAAAATAAGAGAAGAAAAACAAAAAA
TTATCTTAGATCAAGCAAAGGCGCTAGAGACCCAATATGTGCATAATGCGTTAAAAAGAAACCCTGTGCC
TAGAAACTACAATTACTACCAAGCGCCTGAAAAACGCTCTAAACATATTATGCCCTCTGAAATTTTTGAT
GATGGCACATTCACTTATTTTGGTTTCAAAAACATCACTCTCCAACCTGCTATTTTTGTGGTTCAACCTG
ATGGGAAATTGAGCATGACTGATGCCGCCATTGATCCTAACATGACTAATTCAGGATTGAGATGGTATAG
AGTTAATGAAATTGCAGAGAAGTTTAAGCTCATTAAAGACAAAGCCCTTGTAACAGTGATCAATAAAGGC
TATGGGAAAAATCCATTGACAAAAAATTACAATATCAAAAACTATGGTGAATTGGAGCGTGTGATTAAAA
AGCTCCCTCTTGTCAGAGATAAATAA
 Primer design