SecReT4
Protein ID: 308184310
T4SS name [ID]Cag [32]
Gene symbol-
Locus tagHPSJM_02650
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]525301..530781 [+]
Productcag island protein
Component typeCagY
UniProt IDE1PYY5
KEGG IDhpm:HPSJM_02650
PDB IDNA
Domain hit(s) vs Pfam CagY_M [PF07337], Evalue: 0, Aligned region: 332..358
CagY_M [PF07337], Evalue: 0, Aligned region: 366..393
CagY_M [PF07337], Evalue: 0, Aligned region: 403..431
CagY_M [PF07337], Evalue: 0, Aligned region: 445..477
CagY_M [PF07337], Evalue: 0, Aligned region: 478..508
CagY_M [PF07337], Evalue: 0, Aligned region: 514..546
CagY_M [PF07337], Evalue: 0, Aligned region: 548..571
CagY_M [PF07337], Evalue: 0, Aligned region: 583..615
CagY_M [PF07337], Evalue: 0, Aligned region: 622..654
CagY_M [PF07337], Evalue: 0, Aligned region: 660..692
CagY_M [PF07337], Evalue: 0, Aligned region: 693..721
CagY_M [PF07337], Evalue: 0, Aligned region: 729..761
CagY_M [PF07337], Evalue: 0, Aligned region: 767..799
CagY_M [PF07337], Evalue: 0, Aligned region: 805..837
CagY_M [PF07337], Evalue: 0, Aligned region: 843..875
CagY_M [PF07337], Evalue: 0, Aligned region: 881..913
CagY_M [PF07337], Evalue: 0, Aligned region: 919..950
CagY_M [PF07337], Evalue: 0, Aligned region: 952..980
CagY_M [PF07337], Evalue: 0, Aligned region: 988..1020
CagY_M [PF07337], Evalue: 0, Aligned region: 1026..1058
CagY_M [PF07337], Evalue: 0, Aligned region: 1065..1096
CagY_M [PF07337], Evalue: 0, Aligned region: 1098..1126
CagY_M [PF07337], Evalue: 0, Aligned region: 1134..1166
CagY_M [PF07337], Evalue: 0, Aligned region: 1172..1204
CagY_M [PF07337], Evalue: 0, Aligned region: 1210..1242
CagY_M [PF07337], Evalue: 0, Aligned region: 1249..1281
CagY_M [PF07337], Evalue: 0, Aligned region: 1288..1322
CagY_M [PF07337], Evalue: 0, Aligned region: 1327..1354
CagY_M [PF07337], Evalue: 0, Aligned region: 1376..1410
TrbI [PF03743], Evalue: 5.5e-36, Aligned region: 1590..1786
Protein Sequence: 1826 a.a.     [Download]
>gi|308184310|ref|YP_003928443.1| cag island protein [Helicobacter pylori SJM180]
MNEENDKLETSKKAQQHSPQDLSNEEATEANHFEDLLKEESSDNHLDNSTETQTHFDEDKLEETQTQMDS
EGNETSESSNGSLADKLFKKARKLVDNKRPFTQQKNLDEETQELNEEDDQENNEYQEETQTGLIDDETSK
KAQQHSPQDLSNEEATEVNHFEDLLKEESSDNHLDNPTESSDNHLDNSTESSDNHLDNPTETKTQETKTH
FDEDKLEEITDDSNDQEIIKGSKKKYIIGGIVVAVLIVIILFSRSIFHYFMPLEDKSSRFSKDRNLYVND
EIQIRQEYNRLLKERNEKGNMIDKNLFFNDDPNRTLYNYLNIAEIEDKNPLRAFYECIGNGGNYEECLKL
IKDKKLQEQMKKTLEAYNDCIKNAKTEEERIKCLDLIKDENLKKSLLNQQKVQVALDCLKNAKTDEERKE
CLKLINDPEIREKFRKELELQKELQEYKDCIKNAKTEAEKNECLKGLSKEAIERLKQQALDCLKNAKTDE
ERNECLKNIPQDLQKELLADMSVKAYKDCVSRARNEKEKKECEKLLTPEAKKKLEQQVLDCLKNAKTDEE
RKKCLKDLPKDLQSDILAKESLKAYKDCTSQAKTEDEKKECEKLLTPEAKKLLEEEAKESVKAYLDCVSQ
AKTEDEKKECEKLLTPEAKKKLEEAKKSVKAYLDCVSQAKTEDEKKECEKLLTPEAKKLLEQQALDCLKN
AKTDEERKECLKDLPKDLQKKVLAKESVRVYLDCVSKAKNEAERKECEKLLTPEARKLLEEAKESVKAYL
DCVSRARNEKEKKECEKLLTPEARKLLEESKKSVKAYLDCVSQAKNEAERKECEKLLTPEARKLLEEAKE
SVKAYKDCVSRARNEKEKKECEKLLTPEARKLLEESKKSVKAYLDCVSQAKNEAERKECEKLLTPEARKL
LEEAKKSVKAYLDCVSRARNEKEKKECEKLLTPEARKLLENQALDCLKNAKTEAEKKRCVKDLPKDLQKK
VLAKESVRVYLDCVSKAKNEAERKECEKLLTPEARKLLEEAKESVKAYKDCVSRARNEKEKQECEKLLTP
EARKLLEQEVKKSVKAYLDCVSRARNEKEKKECEKLLTPKARKLLENQALDCLKNAKTEAEKKRCVKDLP
KDLQKKVLAKKSVKAYLDCVSRARNEKEKQECEKLLTPEARKLLEEAKKSVKAYLDCVSRARNEKEKQEC
EKLLTPEARKLLEEAKESLKAYKDCLSQARNETERRACEKLLTPEARKLLEQEVKKSVKAYLDCVSRARN
EKEKQECEKLLTPEARKFLEKQRQQKDKAIKDCLKNADPNDRAAIMKCLDGLSDEEKLKYLQEAREKAVL
DCLKTARTDEEKRKCQNLYSDLIQEIQNKRAQNKQNQLSKTERLHQASECLDNLDDPTDQEAIEQCLEGL
SDSERALILGIKRQADEVDRIYSDLRSRKTFDNMAAKGYPLLPMDFKNGGDIATINATNVDADKIASDNP
IYASIEPDITKQYETEKTIKDKSLEAKLAKALGGDKKDDDKEKSKKPTAETKAESNKIDKDVAETAKNIS
EIALKNKKEKSGDFVDENGNPIDDKKKEEKQDETSPVKQAFIGKSDPTFVLAQYTPIEITLTSKVDATLT
GIVSGVVAKDVWNMNGTMILLDKGTKVYGNYQSVKGGTPIMTRLMIVFTKAITPDGVIIPLANAQAAGML
GEAGVDGYVNNHFMKRIGFAVIASVVNSFLQTAPIIALDKLIGLGKGRSERTPEFNYALGQAINGSMQSS
AQMSNQILGQLMNIPPSFYKNEGDSIKILTMDDIDFSGVYDVKITNKSVVDEIIKQSTKTLSREHEEITT
SPKGGN
 
Nucleotide Sequence: 5481 bp     [Download]
>gi|308183796|ref|NC_014560.1|:525301-530781 Helicobacter pylori SJM180 chromosome, complete genome
ATGAATGAAGAAAACGATAAACTTGAAACTTCTAAAAAAGCCCAACAACATTCACCCCAAGATCTATCTA
ATGAAGAAGCAACAGAAGCCAATCATTTTGAAGATCTTTTAAAAGAAGAAAGCTCAGACAATCATCTTGA
CAATTCCACAGAAACTCAAACCCATTTTGATGAAGACAAGCTAGAAGAAACCCAAACTCAAATGGATTCT
GAAGGTAATGAAACTTCAGAATCTAGCAATGGCAGTCTAGCAGACAAGTTATTCAAAAAAGCCAGAAAAT
TAGTTGATAATAAAAGACCTTTCACTCAGCAAAAGAATTTAGATGAAGAAACCCAAGAATTGAACGAAGA
AGACGATCAAGAAAATAATGAGTATCAAGAAGAAACTCAAACGGGCTTAATTGATGATGAAACTTCTAAA
AAAGCCCAACAACATTCACCCCAAGATTTATCCAATGAAGAAGCAACAGAAGTCAATCATTTTGAAGATC
TTTTAAAAGAAGAAAGCTCAGACAATCATCTTGACAACCCCACAGAAAGCTCAGACAATCATCTTGACAA
TTCCACAGAAAGCTCAGACAATCATCTTGACAACCCCACAGAAACTAAAACCCAAGAAACTAAAACCCAT
TTTGATGAAGACAAGCTAGAAGAAATAACTGACGACTCTAACGATCAAGAGATTATCAAAGGAAGCAAAA
AGAAATACATTATTGGTGGCATTGTAGTCGCTGTTCTTATCGTGATTATTTTATTTTCTAGAAGCATTTT
TCACTACTTTATGCCTTTGGAAGATAAAAGCTCTCGTTTTAGCAAAGACAGGAATCTTTATGTCAATGAT
GAAATCCAAATAAGGCAAGAGTATAACCGATTGCTGAAAGAACGGAATGAAAAAGGCAATATGATCGATA
AGAATCTTTTCTTCAATGACGATCCCAATAGAACCTTATACAACTATTTGAATATTGCAGAAATTGAGGA
CAAAAACCCATTGAGAGCCTTTTATGAGTGTATTGGTAATGGTGGCAACTATGAAGAATGTTTGAAGCTT
ATCAAAGACAAAAAACTTCAAGAGCAAATGAAAAAGACTCTAGAGGCTTATAATGATTGTATCAAAAATG
CCAAAACTGAAGAAGAAAGGATCAAGTGTTTAGATTTAATCAAAGATGAAAACCTGAAAAAAAGCTTACT
GAACCAACAAAAAGTTCAAGTGGCGCTAGATTGTTTGAAAAACGCTAAAACCGATGAAGAACGGAAAGAG
TGCCTAAAACTCATAAATGACCCTGAGATTAGAGAGAAATTCCGTAAGGAATTAGAGCTTCAAAAAGAGC
TTCAAGAGTATAAGGATTGTATCAAAAACGCCAAAACAGAAGCTGAGAAAAACGAATGCTTGAAAGGCTT
ATCTAAAGAAGCTATAGAAAGATTGAAACAACAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGATGAA
GAACGAAACGAGTGCTTGAAAAATATTCCCCAAGACTTGCAAAAAGAACTACTAGCTGATATGAGCGTCA
AGGCTTACAAGGACTGCGTTTCAAGAGCTAGGAATGAAAAAGAGAAAAAAGAGTGTGAGAAATTGCTCAC
GCCTGAAGCGAAAAAAAAGTTAGAACAACAGGTTCTAGATTGTCTGAAAAACGCTAAAACCGATGAAGAA
CGAAAAAAGTGTTTGAAAGATCTCCCTAAAGACTTACAAAGCGATATTTTAGCTAAAGAGAGTCTGAAAG
CTTATAAAGACTGCACATCTCAAGCCAAAACTGAAGATGAGAAAAAAGAGTGTGAGAAATTACTCACCCC
TGAAGCGAAAAAACTTTTAGAAGAAGAAGCCAAAGAGAGCGTTAAGGCTTATTTGGATTGCGTATCTCAA
GCCAAAACTGAAGATGAGAAAAAAGAGTGTGAGAAATTACTCACCCCTGAAGCGAAAAAAAAGTTAGAAG
AAGCTAAAAAAAGCGTTAAGGCTTATTTGGATTGCGTATCTCAAGCCAAAACTGAAGATGAGAAAAAAGA
GTGTGAGAAATTACTCACCCCTGAAGCGAAAAAACTTTTAGAGCAACAAGCACTAGATTGTTTGAAAAAC
GCTAAAACCGATGAAGAACGGAAAGAGTGCTTGAAAGATCTCCCTAAAGACTTACAGAAAAAGGTTTTAG
CCAAAGAGAGTGTTAGGGTTTATTTGGATTGCGTATCAAAAGCCAAAAACGAAGCTGAAAGAAAAGAATG
CGAGAAATTGCTCACGCCTGAAGCGAGGAAACTATTAGAAGAAGCTAAAGAGAGCGTTAAGGCTTATTTA
GACTGCGTTTCAAGAGCTAGGAATGAAAAAGAGAAAAAAGAGTGTGAGAAATTACTCACTCCTGAAGCGA
GAAAACTATTAGAAGAATCTAAAAAAAGCGTTAAGGCTTATTTGGATTGCGTATCTCAAGCCAAAAACGA
AGCTGAAAGAAAAGAATGCGAGAAATTGCTCACCCCTGAAGCGAGAAAACTTTTAGAAGAAGCTAAAGAG
AGCGTTAAGGCTTACAAGGACTGCGTATCAAGAGCTAGGAATGAAAAAGAGAAAAAAGAGTGTGAGAAAT
TACTCACGCCTGAAGCGAGGAAACTATTAGAAGAATCTAAAAAAAGCGTTAAGGCTTATTTGGATTGCGT
ATCTCAAGCCAAAAACGAAGCTGAAAGAAAAGAATGCGAGAAATTACTCACGCCTGAAGCGAGAAAACTT
TTAGAAGAAGCTAAAAAGAGCGTTAAGGCTTATTTAGACTGCGTATCAAGAGCTAGGAATGAAAAAGAGA
AAAAAGAGTGTGAGAAATTACTCACCCCTGAAGCGAGGAAACTATTAGAGAATCAAGCACTAGATTGTTT
GAAAAACGCTAAAACCGAAGCTGAGAAAAAAAGGTGTGTCAAAGATCTCCCTAAAGACTTACAGAAAAAG
GTTTTAGCCAAAGAGAGTGTTAGGGTTTATTTGGATTGCGTGTCAAAAGCCAAAAACGAAGCTGAAAGAA
AAGAATGCGAGAAATTACTCACGCCTGAAGCGAGAAAACTTTTAGAAGAAGCTAAAGAGAGCGTTAAGGC
TTACAAAGACTGCGTATCAAGAGCTAGGAACGAAAAAGAGAAGCAAGAATGCGAGAAATTACTCACCCCT
GAAGCGAGGAAACTATTAGAGCAAGAAGTTAAAAAGAGCGTTAAGGCTTATTTAGACTGCGTATCAAGAG
CTAGGAATGAAAAAGAGAAAAAAGAGTGTGAGAAATTGCTCACCCCTAAAGCGAGGAAACTATTAGAGAA
TCAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGAAGCTGAGAAAAAAAGGTGTGTCAAAGATCTCCCT
AAAGACTTACAGAAAAAGGTTTTAGCTAAAAAAAGCGTTAAGGCTTATTTAGACTGCGTTTCAAGAGCTA
GGAATGAAAAAGAGAAACAAGAATGCGAGAAATTACTCACGCCTGAAGCGAGAAAGCTATTAGAAGAAGC
TAAAAAAAGCGTTAAGGCTTATTTAGACTGCGTTTCAAGAGCTAGGAATGAAAAAGAGAAACAAGAATGC
GAGAAATTACTCACGCCTGAAGCGAGAAAGCTATTAGAAGAAGCTAAAGAGAGCCTTAAAGCTTATAAAG
ACTGTCTCTCTCAAGCTAGAAATGAAACTGAAAGGAGAGCCTGCGAGAAATTACTCACCCCTGAAGCGAG
AAAACTATTAGAGCAAGAAGTTAAAAAGAGCGTTAAGGCTTATTTAGACTGCGTTTCAAGAGCTAGGAAT
GAAAAAGAGAAACAAGAATGCGAGAAATTACTCACGCCTGAAGCGAGGAAATTTTTAGAGAAACAGCGCC
AACAAAAAGATAAAGCGATAAAGGATTGCTTGAAAAACGCCGATCCTAACGACAGAGCGGCTATCATGAA
GTGTTTGGATGGTTTGAGCGATGAAGAGAAGCTCAAATACCTGCAAGAAGCTAGAGAAAAGGCTGTCTTG
GATTGTTTGAAAACGGCTAGGACCGATGAAGAAAAAAGAAAATGCCAAAACCTTTATAGCGATTTGATCC
AAGAAATCCAAAATAAAAGGGCACAGAACAAACAAAATCAATTGAGTAAAACAGAAAGGTTGCATCAAGC
AAGCGAGTGCTTGGATAACTTAGATGACCCTACTGATCAAGAAGCCATAGAGCAATGTTTAGAGGGATTG
AGCGATAGCGAAAGGGCGCTAATTCTAGGAATCAAACGACAAGCTGATGAAGTGGATCGGATTTATAGCG
ATCTAAGAAGCCGCAAAACCTTTGATAACATGGCGGCTAAAGGTTATCCATTGTTACCAATGGATTTCAA
AAATGGTGGCGATATTGCCACTATTAACGCCACTAATGTTGATGCGGACAAAATAGCTAGCGATAATCCT
ATTTATGCTTCCATAGAGCCTGATATTACTAAGCAATACGAAACAGAGAAAACCATTAAGGATAAGAGTT
TAGAAGCTAAATTAGCTAAGGCTTTAGGTGGCGATAAAAAAGATGACGATAAAGAAAAAAGTAAAAAACC
CACAGCAGAAACTAAAGCAGAAAGCAATAAGATAGACAAAGATGTCGCAGAAACTGCCAAAAATATCAGC
GAAATCGCTCTTAAGAACAAAAAAGAAAAGAGTGGGGATTTTGTAGATGAAAATGGTAATCCCATTGACG
ATAAAAAGAAAGAAGAAAAACAAGATGAAACAAGCCCTGTCAAACAGGCCTTTATAGGCAAGAGTGATCC
CACATTTGTTTTAGCGCAATACACTCCCATTGAAATCACTCTGACTTCTAAAGTAGATGCCACTCTCACG
GGTATAGTGAGTGGGGTTGTAGCCAAAGATGTATGGAACATGAACGGCACTATGATCTTATTAGACAAAG
GCACTAAGGTGTATGGGAATTATCAAAGCGTGAAAGGTGGCACACCTATTATGACTCGTTTAATGATAGT
CTTTACTAAAGCCATTACGCCTGATGGGGTGATTATACCTCTAGCAAACGCTCAAGCAGCAGGCATGTTG
GGTGAAGCAGGGGTAGATGGCTATGTGAATAATCACTTCATGAAGCGCATAGGCTTTGCTGTGATAGCAA
GCGTGGTTAATAGCTTCTTGCAAACCGCGCCTATCATAGCCCTAGATAAACTCATAGGCCTTGGCAAAGG
CAGAAGTGAAAGGACACCTGAATTTAATTACGCTTTGGGTCAAGCTATCAATGGCAGTATGCAAAGTTCA
GCTCAGATGTCTAATCAAATTCTAGGGCAACTGATGAATATCCCCCCAAGTTTTTACAAAAATGAGGGCG
ATAGCATTAAGATTCTCACAATGGACGATATTGATTTTAGCGGCGTGTATGATGTTAAAATTACCAACAA
ATCTGTGGTAGATGAAATTATCAAACAAAGCACCAAAACTTTGTCTAGAGAACATGAAGAAATCACCACA
AGCCCCAAAGGTGGCAATTGA
 Primer design