SecReT4
Protein ID: 308184313
T4SS name [ID]Cag [32]
Gene symbol-
Locus tagHPSJM_02665
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]532521..534767 [+]
Productcag island protein, DNA transfer protein
Component typeCagbeta
UniProt IDE1PYY8
KEGG IDhpm:HPSJM_02665
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.3e-179, Aligned region: 177..713
TraG-D_C [PF12696], Evalue: 7.7e-24, Aligned region: 545..668
TrwB_AAD_bind [PF10412], Evalue: 1.9e-10, Aligned region: 509..672
Protein Sequence: 748 a.a.     [Download]
>gi|308184313|ref|YP_003928446.1| cag island protein, DNA transfer protein [Helicobacter pylori SJM180]
MEDFLYNTLYFIEDYKLVVIFSFIGLLVLFFLYKFIKTQKKALKDKANQPQKKKSFKEIIIDGLKERVKT
FGFWLQAILLLSYSFITSGLFFLILLGNFYDDNKLPESDDDLFDIWVYAIQDFPAYYFKALTFSSLKIYG
FNISLVVYSSILCSYLFITFFVWFLKYLTRTRDIGANKKVDDLFGSASWETEEKMIKAKLITPNNKKRAF
DKREVIVGRRGLGDFIAYAGQAFIGLIAPTRSGKGVGFIMPNMINYPQNIVVFDPKADTMETCGKIREKR
FNQKVFIYEPFSLKTHRFNPFAYVDFGNDVVLTEDILSQIDTRLKGHGMVASGGDFSTQIFGLAKLVFPE
RPNEKDPFFSNQARNLFVINCNIYRDLMWTKKGLEFVKRKKIIMPETPTMFFIGSMASGINLIDEDTNME
KVVSLMEFFGGEEDKSGDNLRALSPATRNMWNSFKTMGGARETYSSVQGVYTSAFAPYNNAMIRNFTSAN
DFDFRRLRIDAVSIGVIANPKESTIVGPILELFFNVMIYSNLILPIHDPQCKRSCLMLMDEFTLCGYLET
FVKAVGIMAEYNMRPAFVFQSKAQLENDPPLGYGRNGAKTILDNLSLNMYYGINNDNYYEHFEKLSKVLG
KYTRQDVSRSIDDNTGKTNTSISNKERFLMTPDELMTMGDELIILENTLKPIKCHKALYYDDPFFTDELI
KVSPSLSKKYKLGKVPDQTTFYDDLQAAKTRGELSYDKSLVPVGSSEL
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|308183796|ref|NC_014560.1|:532521-534767 Helicobacter pylori SJM180 chromosome, complete genome
ATGGAAGACTTTTTGTATAACACCTTATACTTCATAGAGGATTATAAGTTGGTTGTTATTTTTAGTTTCA
TAGGGTTATTAGTGTTATTTTTCCTCTACAAATTCATAAAAACTCAAAAAAAGGCTCTTAAAGATAAAGC
CAATCAGCCTCAAAAGAAAAAAAGCTTTAAAGAAATCATTATAGATGGGCTGAAAGAAAGGGTTAAAACC
TTTGGCTTTTGGTTGCAAGCGATACTATTACTATCCTATTCTTTTATCACATCAGGGTTATTTTTCTTGA
TTCTCTTAGGTAATTTTTATGATGATAATAAATTGCCTGAGAGCGATGATGATCTTTTTGATATATGGGT
CTATGCGATACAAGATTTTCCTGCATACTATTTTAAGGCGCTCACTTTTAGCTCGCTCAAGATTTATGGG
TTCAATATATCCTTAGTCGTATATAGTTCTATTTTATGCTCTTATCTATTCATTACCTTTTTTGTGTGGT
TCTTAAAATACTTAACTCGGACTAGAGACATAGGAGCGAATAAAAAAGTTGATGATCTCTTTGGTAGTGC
GAGTTGGGAAACTGAAGAAAAAATGATCAAAGCCAAGCTTATCACACCCAACAATAAAAAACGTGCCTTT
GACAAACGAGAGGTGATTGTAGGCAGGCGTGGCTTAGGGGATTTTATCGCTTACGCAGGACAGGCGTTTA
TTGGCTTGATTGCTCCCACTAGAAGCGGTAAAGGTGTGGGTTTCATCATGCCCAATATGATCAATTATCC
TCAAAATATCGTTGTGTTTGATCCTAAGGCTGACACTATGGAAACTTGCGGGAAAATCAGAGAGAAACGC
TTCAACCAAAAAGTGTTCATCTATGAACCTTTCTCCTTAAAAACACACCGATTTAATCCTTTCGCTTATG
TGGATTTTGGTAATGATGTGGTTTTGACCGAAGACATACTCTCTCAAATTGACACACGCCTAAAAGGGCA
TGGCATGGTGGCTAGTGGAGGGGATTTTTCCACTCAAATCTTTGGATTGGCAAAGCTCGTGTTCCCTGAA
AGACCTAATGAAAAAGATCCTTTTTTTAGCAATCAGGCGCGAAACCTTTTTGTCATCAATTGCAATATTT
ACAGGGATCTCATGTGGACTAAAAAGGGGCTTGAGTTTGTCAAAAGAAAAAAAATCATCATGCCTGAAAC
CCCTACGATGTTTTTCATAGGCTCTATGGCAAGCGGGATCAACTTGATTGATGAAGACACAAACATGGAA
AAAGTCGTGTCTTTAATGGAATTTTTTGGAGGTGAAGAAGATAAGAGTGGCGACAATCTAAGAGCGCTTA
GTCCTGCCACTAGAAACATGTGGAATAGCTTCAAGACAATGGGTGGTGCTAGAGAAACTTATAGCTCTGT
TCAAGGGGTATATACTTCAGCTTTTGCGCCTTATAATAACGCCATGATTAGAAATTTCACGAGCGCTAAT
GATTTTGATTTCAGGCGTTTAAGGATCGATGCAGTGAGTATTGGTGTGATCGCTAATCCTAAAGAAAGCA
CTATTGTTGGACCGATATTAGAGCTGTTTTTTAACGTGATGATTTATAGCAATTTGATTCTACCAATCCA
TGATCCACAATGCAAAAGAAGTTGCTTGATGCTCATGGACGAATTCACTTTGTGTGGCTATTTAGAGACC
TTTGTTAAAGCGGTAGGGATCATGGCAGAATACAACATGCGCCCCGCTTTTGTGTTTCAAAGTAAGGCAC
AACTAGAGAATGACCCCCCACTTGGTTATGGTAGGAATGGCGCTAAGACTATTTTAGACAACCTTTCTTT
GAATATGTATTATGGAATCAACAACGATAACTACTATGAACACTTTGAAAAACTTTCTAAAGTGTTAGGG
AAATACACAAGACAAGACGTGAGCCGAAGCATTGATGACAATACAGGTAAGACCAACACTTCTATCAGCA
ACAAGGAGCGGTTTTTGATGACCCCTGATGAATTGATGACTATGGGCGATGAGCTTATTATTTTAGAAAA
TACGCTCAAACCTATCAAATGCCACAAGGCGCTTTACTACGATGATCCTTTCTTCACCGATGAACTCATT
AAGGTGAGTCCAAGTTTGAGCAAGAAATACAAATTGGGGAAAGTGCCTGATCAGACGACTTTTTATGATG
ATTTGCAAGCCGCTAAAACCAGAGGTGAATTGAGTTATGACAAGTCTTTAGTGCCTGTGGGTTCAAGCGA
ACTGTGA
 Primer design