SecReT4
Protein ID: 308184315
T4SS name [ID]Cag [32]
Gene symbol-
Locus tagHPSJM_02675
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]535405..536850 [-]
Productcag pathogenicity island protein 3
Component typeCagdelta
UniProt IDE1PYZ0
KEGG IDhpm:HPSJM_02675
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 481 a.a.     [Download]
>gi|308184315|ref|YP_003928448.1| cag pathogenicity island protein 3 [Helicobacter pylori SJM180]
MFRKLATAVLLMGLLISNTLYAKEISEADKVIKATKETKETKKEAKRLKKEAKQRQQIPDHKKPQYVSVD
DTKTQALFDIYDTLNVNDKSFGDWFGNSALKDKTYLYAMDLLDYNNYLSIENPIIKTRAMGTYADLIIIT
GSLEQVNGYYNILKALNKRNAKFVLKINENMPYAQATFLRVPKRSDPNAHTLDKGASIDENKLFEQQKRA
YFNYANDVICRPNDEVCSPLRDEMVAMPTSDSVKQKPNIIAPYSLYRLKETNNANEAQPSPYATQTAPEN
SKEKLIEELIANSQLIANEEEREKKLLAEKEKQEVELAKYKLKDLENQKKLKALEAELKKKNAKKPRVVE
VPISPKTGNSDETMRVVKEKENYNGLLVDKETTIKRSYEGTLISENSYSKKTPLNPNDLRSLEEEIKSYY
IKSNGLCYANGISLYVKIKNDPYKEGMLCGYESVQTLLLPLKDKLKYDKQKLQKALLKDSK
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|308183796|ref|NC_014560.1|:c536850-535405 Helicobacter pylori SJM180 chromosome, complete genome
ATGTTTAGAAAACTAGCAACCGCTGTATTACTCATGGGCTTACTAATCTCTAACACTCTTTATGCTAAAG
AAATAAGTGAAGCCGATAAGGTCATTAAGGCCACTAAAGAAACTAAAGAGACCAAGAAAGAAGCTAAACG
ACTCAAAAAAGAAGCTAAACAGCGCCAACAGATCCCTGATCATAAGAAACCTCAATATGTCTCTGTTGAT
GACACAAAAACTCAAGCGCTTTTTGATATATACGACACCTTGAACGTGAATGACAAAAGCTTTGGGGATT
GGTTTGGTAATAGCGCTTTGAAAGACAAAACTTATCTCTACGCTATGGATCTATTGGATTATAACAACTA
CTTATCCATAGAAAACCCTATTATCAAAACAAGAGCGATGGGGACTTATGCGGATCTCATTATCATCACA
GGTTCGTTAGAACAAGTCAATGGGTATTACAACATTCTAAAAGCGCTCAACAAACGAAACGCTAAGTTTG
TGTTAAAAATCAATGAGAACATGCCTTATGCCCAAGCGACTTTTTTACGAGTACCAAAAAGAAGCGATCC
TAATGCCCACACGCTTGATAAGGGAGCGTCAATTGATGAGAACAAGCTTTTTGAACAACAAAAACGCGCG
TATTTCAACTACGCCAACGATGTGATCTGCAGACCCAATGATGAAGTGTGTTCGCCCCTAAGAGATGAGA
TGGTCGCTATGCCCACTAGCGATAGCGTTAAACAAAAACCCAATATCATTGCTCCTTATAGCTTGTATAG
ACTAAAAGAGACAAATAACGCCAATGAGGCCCAACCATCACCTTATGCCACTCAAACCGCTCCTGAAAAC
AGCAAAGAGAAGCTCATAGAAGAGCTAATCGCTAACTCCCAACTCATAGCCAATGAAGAAGAGAGGGAAA
AGAAACTCTTAGCAGAAAAAGAAAAACAAGAGGTTGAATTGGCTAAATACAAGCTCAAAGACTTAGAAAA
TCAAAAGAAACTAAAAGCTTTAGAAGCAGAGTTGAAAAAGAAAAATGCTAAGAAACCTAGAGTAGTGGAA
GTGCCTATTTCCCCTAAAACAGGTAATTCTGATGAAACAATGAGAGTTGTCAAAGAAAAAGAAAACTATA
ATGGATTGTTAGTGGATAAAGAGACCACGATCAAAAGAAGCTATGAGGGGACTTTGATCAGCGAAAATTC
TTACAGCAAAAAAACACCTCTCAACCCTAATGACTTGAGGAGCTTAGAAGAAGAAATCAAAAGCTATTAT
ATCAAGTCTAACGGCTTGTGTTATGCTAATGGCATCAGTCTTTATGTAAAAATCAAAAACGACCCCTATA
AAGAGGGAATGTTGTGTGGTTATGAGAGCGTTCAAACTTTACTTTTGCCATTAAAGGACAAGCTCAAATA
CGACAAGCAAAAGTTACAAAAAGCGTTACTGAAAGATTCAAAGTAA
 Primer design