SecReT4
Protein ID: 308513232
T4SS name [ID]Tra_Tn [650]
Gene symbol-
Locus tagHMPREF0868_1208
StrainClostridiales genomosp. BVAB3 str. UPII9-5
Repliconchromosome [GenBank: NC_013895] [Browse all T4SS(s) in this replicon]
Location [Strand]543464..544579 [+]
Producthypothetical protein
Component typeOrf16_Tn
UniProt IDE1PK67
KEGG IDclo:HMPREF0868_1208
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 371 a.a.     [Download]
>gi|308513232|ref|YP_003933635.1| hypothetical protein HMPREF0868_1208 [Clostridiales genomosp. BVAB3 str. UPII9-5]
MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHALQISTESSIR
SAQERSKNEVTGKLKAVAYDKIDQQTDALISMIGENQVNYRFFIGFKLLLNDQEFSMKSLTVEAKNALSD
FVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFKIRRLDKDDFGYLIEHLYGQTGTAYEEYEYH
LSKKKLDNETLIKYYDLIKPTRCLVEEKQRYLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQF
TFPIDTSMNVEIVANRKALSTVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETNLDQSKESMYK
LSYVVRVSQMILTNSNVVVMK
 
Nucleotide Sequence: 1116 bp     [Download]
>gi|308513210|ref|NC_013895.2|:543464-544579 Clostridiales genomosp. BVAB3 str. UPII9-5 chromosome, complete genome
ATGGCATATCCAATTAAATACATTGAAAACAATCTCGTCTGGAATAAAGACGGGGAATGTTATGCTTACT
ATGAGCTTGTTCCTTACAATTACTCATTTCTAAGTCCAGAACAGAAAATACAAGTGCATGATTCTTTCAG
ACAGCTTATCGCACAAAATCGTGATGGCAAAATTCATGCTTTACAAATCAGTACAGAATCCAGCATACGT
TCTGCACAAGAGCGTTCCAAAAATGAAGTCACTGGCAAGCTCAAAGCGGTTGCCTATGACAAAATCGACC
AACAGACAGACGCTTTAATATCCATGATTGGCGAAAATCAAGTGAACTACCGTTTCTTTATCGGCTTTAA
GTTGCTTCTCAACGATCAGGAGTTTTCTATGAAAAGTCTTACCGTTGAAGCAAAAAATGCTTTGTCTGAT
TTTGTCTATGATGTGAACCATAAGCTGATGGGCGATTTTGTTAGTATGAGTAATGATGAAATCCTGCGTT
TTCAGAAGATGGAAAAGCTCTTAGAAAATAAAATCTCTCGTCGTTTCAAAATCCGCAGGTTAGATAAGGA
CGACTTCGGCTATCTGATTGAACACCTTTACGGACAGACAGGCACTGCCTATGAAGAGTATGAGTACCAT
CTATCAAAGAAAAAGCTGGATAATGAAACGCTGATTAAATACTATGACTTGATTAAGCCTACTCGCTGTT
TGGTGGAAGAAAAACAGCGATATTTGAAAATCCAGCAGGAAGATGAAACCGTCTATGTAGCTTACTTTAC
CATTAACAGCATTGTCGGAGAACTGGACTTCCCGTCCTCTGAAATCTTCTACTACCAGCAACAGCAATTT
ACATTCCCGATTGATACGTCAATGAATGTGGAAATTGTAGCGAATCGTAAAGCCCTATCTACTGTCCGCA
ATAAAAAGAAAGAACTGAAAGACTTGGATAACCACGCTTGGCAAAGTGATAATGAAACCAGCTCCAATGT
GGCGGAAGCTCTGGAAAGTGTGAATGAGCTGGAAACCAATTTAGACCAAAGCAAGGAATCTATGTACAAG
CTGTCTTATGTGGTAAGGGTATCGCAAATGATCTTGACGAACTCAAACGTCGTTGTAATGAAGTGA
 Primer design