SecReT4
Protein ID: 308513233
T4SS name [ID]Tra_Tn [650]
Gene symbol-
Locus tagHMPREF0868_1207
StrainClostridiales genomosp. BVAB3 str. UPII9-5
Repliconchromosome [GenBank: NC_013895] [Browse all T4SS(s) in this replicon]
Location [Strand]544576..545910 [+]
ProductATP/GTP-binding family protein
Component typeOrf16_Tn
UniProt IDE1PK68
KEGG IDclo:HMPREF0868_1207
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.5e-34, Aligned region: 97..392
Protein Sequence: 444 a.a.     [Download]
>gi|308513233|ref|YP_003933636.1| ATP/GTP-binding family protein [Clostridiales genomosp. BVAB3 str. UPII9-5]
MKDFYDDLSVKLVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFLAGLGFGATQMLGENEGIYVGYSLD
TGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFANNLIVYYAVLYGAQAVIVDPKAERGRWKETL
PEISHEINIVTLTSDEKNKGLLDPYVIMKNPKDSESLAIDILTFLTGISSRDGERFPILRKAIRAVTNSE
VRGLMKVIEELRVENTPLSTSIADHIESFTDYDFAHLLFSNGYVEQSISLEKQLNIIQVADLVLPDKETS
FEEYTTMELLSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWSFLQVAQGKTLSMKLVRAGRAMNAGVYF
VTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIKKTLAFFGVDPEDENNQKRLRDLENGQCLISDLYGRVGV
IQFHPVFEELLHAFDTRPPVRKEV
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|308513210|ref|NC_013895.2|:544576-545910 Clostridiales genomosp. BVAB3 str. UPII9-5 chromosome, complete genome
GTGAAAGATTTTTATGACGATTTAAGCGTAAAACTGGTACGACCATTTGGGGATATGCTCGGCTTACATG
AAGAATTTTTACCTGCCAGCAAGCGTTATATGAATGATTATATTCAATACGTGACCTCTGATTTCCTCGC
TGGTTTAGGTTTTGGTGCTACTCAAATGCTGGGGGAAAATGAGGGGATTTATGTTGGCTACAGCTTAGAT
ACTGGACGCAATGTCTATCTGAAACCTGCTCTTGCCAGTCAAGGGGTTAAGGGTTCAGTAACCAATGCGT
TAGCGTCGGCTTTTGTTGGTTCGCTGGGTGGTGGTAAATCCTTTGCGAATAACCTTATCGTCTATTATGC
GGTGCTTTATGGGGCACAAGCAGTGATTGTAGACCCAAAAGCAGAACGTGGCAGATGGAAAGAAACCTTG
CCAGAGATTTCCCATGAAATCAATATCGTCACTCTGACTTCTGATGAGAAAAACAAAGGCTTACTTGACC
CTTATGTGATTATGAAAAATCCCAAAGATTCTGAATCACTGGCTATTGATATTCTGACATTCCTTACGGG
GATTTCCTCTCGTGATGGGGAACGCTTCCCAATCCTTAGAAAAGCCATTCGTGCAGTAACCAATAGTGAA
GTACGAGGGTTGATGAAAGTGATTGAGGAATTACGGGTTGAGAATACGCCACTAAGTACCAGTATAGCCG
ACCATATCGAAAGTTTTACAGACTATGACTTTGCACATTTATTATTCAGTAATGGTTATGTGGAGCAGTC
TATCAGCTTAGAAAAACAACTGAACATTATACAGGTTGCGGACTTGGTACTTCCCGACAAGGAAACTTCC
TTTGAGGAATATACCACTATGGAGCTTTTATCCGTTGCTATGCTGATTGTCATTAGTACCTTTGCTTTAG
ACTTTATCCATACAGACCGAAGCATTTTCAAGATTGTAGATTTAGACGAAGCATGGAGCTTTTTACAGGT
AGCACAAGGAAAAACACTATCTATGAAGCTGGTTCGGGCTGGTCGTGCTATGAACGCTGGGGTATATTTC
GTGACCCAAAATACAGACGACCTCTTAGATGAAAAACTGAAAAATAACCTCGGCTTAAAATTTGCATTTC
GTTCCACTGACCTTAACGAGATTAAAAAGACCTTAGCCTTTTTTGGTGTAGACCCAGAGGACGAAAACAA
TCAGAAGCGATTGCGTGATTTGGAAAACGGGCAATGCCTTATCAGTGATTTATATGGTCGTGTCGGTGTG
ATACAGTTCCACCCTGTATTTGAAGAACTGCTCCATGCCTTTGATACCAGACCACCTGTGCGAAAAGAGG
TGTAA
 Primer design