SecReT4
Protein ID: 310286352
T4SS name [ID]Tra_F [106]
Gene symbolyubQ
Locus tagETN48_p0003
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]1574..2176 [-]
Producttransglycosylase
Component typeOrf169_F
UniProt IDE3PYH3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 200 a.a.     [Download]
>gi|310286352|ref|YP_003937613.1| transglycosylase [Escherichia coli]
MVLLVVRTTNLLSLFVEWVKLFTDKVTRGGKMKKWMLTICLMFINEICQATDCFDLAGRDYKIDPDLLRA
ISWQESRYRVNAIGINPVTGYGSGLMQVDSQHFNELARYGIKPEHLTTDPCMNIYTGAYYLAIAFKKWGV
TWEAVGAYNAGFRKTERQNQRRLAYASDVYRIYTGIKSSKGIRLPATKKSLPEINSVQNN
 
Nucleotide Sequence: 603 bp     [Download]
>gi|310286349|ref|NC_014615.1|:c2176-1574 Escherichia coli plasmid pETN48, complete sequence
GTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCTTTTTGTGGAGTGGGTTAAATTATTTACGG
ATAAAGTCACCAGAGGTGGAAAAATGAAAAAATGGATGTTAACCATCTGCCTGATGTTTATAAATGAGAT
CTGCCAGGCCACTGATTGCTTTGATCTTGCAGGCCGGGATTACAAAATAGATCCTGATTTACTGAGAGCA
ATATCATGGCAAGAATCCCGTTACCGGGTTAATGCCATCGGTATTAATCCGGTAACGGGATATGGCAGCG
GACTGATGCAGGTAGATTCCCAGCATTTTAACGAACTGGCCCGCTACGGAATTAAGCCAGAACATCTGAC
AACAGATCCCTGCATGAACATTTATACCGGTGCTTATTATCTGGCAATAGCATTTAAAAAATGGGGCGTC
ACCTGGGAGGCCGTTGGTGCATACAATGCCGGATTCAGGAAAACCGAACGCCAGAACCAGAGACGTCTTG
CCTACGCATCAGATGTTTACCGGATTTATACTGGGATAAAAAGCAGTAAAGGTATCCGGCTTCCGGCCAC
GAAGAAATCACTTCCGGAAATTAACAGCGTGCAGAACAATTAA
 Primer design