SecReT4
Protein ID: 310286353
T4SS name [ID]Tra_F [106]
Gene symboltraM
Locus tagETN48_p0004
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]2497..2880 [+]
Productconjugal transfer protein M
Component typeTraM_F
UniProt IDQ84A34, B7LI62
KEGG IDecz:pECS88_0063
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 1e-59, Aligned region: 1..127
Protein Sequence: 127 a.a.     [Download]
>gi|310286353|ref|YP_003937614.1| conjugal transfer protein M [Escherichia coli]
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDDE
 
Nucleotide Sequence: 384 bp     [Download]
>gi|310286349|ref|NC_014615.1|:2497-2880 Escherichia coli plasmid pETN48, complete sequence
ATGGCTAAGGTGAACCTGTATATCAGCAATGATGCCTATGAAAAAATAAATGCGATTATTGAGAAGCGTC
GACAGGAAGGGGCAAGGGAAAAAGATGTCAGTTTTTCAGCAACAGCTTCAATGCTTCTTGAACTGGGGCT
TCGTGTACATGAGGCTCAGATGGAGCGTAAAGAGTCTGCATTTAATCAGACTGAGTTTAATAAATTGCTT
CTTGAATGCGTTGTAAAAACACAATCATCAGTAGCGAAAATTTTGGGTATTGAGTCTCTCAGTCCTCATG
TCTCCGGAAATCCAAAGTTTGAATATGCCAATATGGTTGAAGATATCAGGGAGAAGGTATCATCTGAGAT
GGAACGATTTTTTCCAAAAAATGATGATGAATAA
 Primer design