SecReT4
Protein ID: 310286355
T4SS name [ID]Tra_F [106]
Gene symboltraY
Locus tagETN48_p0006
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]3849..4250 [+]
ProductoriT nicking conjugative transfer protein
Component typeTraY_F
UniProt IDE3PYH6, B7LI64
KEGG IDecz:pECS88_0065
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 4.5e-38, Aligned region: 17..60
TraY [PF05509], Evalue: 4.5e-38, Aligned region: 72..119
Protein Sequence: 133 a.a.     [Download]
>gi|310286355|ref|YP_003937616.1| oriT nicking conjugative transfer protein [Escherichia coli]
MLLKRFGTRSATGKMVKLKLPVDVESLLIEASNRSGRSRSFEAVIRLKDHLHRYPKFNRAGNIYGKSLVK
YLTMRLDDETNQLLIAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIFREADKEEDITFNTL
 
Nucleotide Sequence: 402 bp     [Download]
>gi|310286349|ref|NC_014615.1|:3849-4250 Escherichia coli plasmid pETN48, complete sequence
GTGTTATTGAAAAGATTTGGTACACGTTCTGCAACAGGTAAGATGGTAAAACTAAAATTACCTGTAGATG
TGGAAAGTCTATTAATTGAGGCAAGTAACAGAAGCGGAAGAAGTCGATCGTTTGAGGCAGTAATAAGACT
TAAAGATCATCTTCACCGCTATCCAAAGTTTAACAGGGCAGGGAATATCTATGGTAAGTCGCTGGTTAAG
TATCTGACAATGCGTCTGGATGATGAAACTAACCAGCTACTTATTGCAGCCAAAAATCGTAGTGGATGGT
GTAAAACAGATGAGGCTGCAGACAGAGTTATTGATCATTTGATCAAGTTTCCTGATTTTTATAACTCGGA
GATATTCAGGGAGGCAGATAAAGAGGAAGATATAACATTTAATACACTCTAG
 Primer design