SecReT4
Protein ID: 310286356
T4SS name [ID]Tra_F [106]
Gene symboltraA
Locus tagETN48_p0007
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]4283..4648 [+]
Productfimbrial protein precursor TraA
Component typeTraA_F
UniProt IDB7LI65, P04737, Q7B3W8
KEGG IDecz:pECS88_0066
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 1.9e-59, Aligned region: 1..120
Protein Sequence: 121 a.a.     [Download]
>gi|310286356|ref|YP_003937617.1| fimbrial protein precursor TraA [Escherichia coli]
MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMAAGSSGQDLMASGNTTVKAT
FGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL
 
Nucleotide Sequence: 366 bp     [Download]
>gi|310286349|ref|NC_014615.1|:4283-4648 Escherichia coli plasmid pETN48, complete sequence
ATGAATGCTGTTTTAAGTGTTCAGGGTGCTTCTGCGCCCGTCAAAAAGAAGTCGTTTTTTTCTAAATTCA
CTCGTCTGAATATGCTTCGCCTGGCTCGCGCAGTGATCCCGGCTGCTGTTCTGATGATGTTCTTCCCGCA
GCTGGCGATGGCCGCCGGCAGCAGTGGTCAGGACCTGATGGCAAGCGGTAACACCACGGTTAAGGCGACC
TTCGGTAAGGACTCCAGTGTTGTTAAATGGGTTGTTCTGGCTGAAGTTCTGGTCGGTGCTGTCATGTACA
TGATGACCAAAAACGTCAAGTTCCTGGCCGGTTTTGCCATCATCTCTGTATTTATTGCTGTGGGTATGGC
CGTCGTTGGCCTCTGA
 Primer design