SecReT4
Protein ID: 310286357
T4SS name [ID]Tra_F [106]
Gene symboltraL
Locus tagETN48_p0008
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]4663..4974 [+]
ProductF pilus assembly protein TraL
Component typeTraL_F
UniProt IDB7LI66, B7LWZ4, Q7B3W7
KEGG IDecz:pECS88_0067
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.3e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|310286357|ref|YP_003937618.1| F pilus assembly protein TraL [Escherichia coli]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|310286349|ref|NC_014615.1|:4663-4974 Escherichia coli plasmid pETN48, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design