SecReT4
Protein ID: 310286358
T4SS name [ID]Tra_F [106]
Gene symboltraE
Locus tagETN48_p0009
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]4996..5562 [+]
ProductF pilus assembly protein TraE
Component typeTraE_F
UniProt IDQ7B3W6, B7LWZ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 8.6e-74, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|310286358|ref|YP_003937619.1| F pilus assembly protein TraE [Escherichia coli]
MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNVIQGVNNYRLQNEQRTAVTPMAFNAPFAVSQNSADASYL
QQMALSFIALRLNVSSETVDASHQALLQYIRPGAQNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYG
RVEIRGVLKTWIGDSKPFTDIKHYILILKRENGVTWLDNFGETDDEKK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|310286349|ref|NC_014615.1|:4996-5562 Escherichia coli plasmid pETN48, complete sequence
ATGGAACACGGTGCCCGTTTAAGTACCAGTCGTGTAATGGCCATCGCCTTTATATTTATGTCAGTGCTTA
TTGTTCTCAGCCTCTCTGTTAACGTCATTCAGGGGGTGAATAACTACCGTCTTCAGAATGAGCAACGCAC
TGCCGTGACGCCAATGGCATTTAATGCCCCCTTTGCCGTGTCACAGAACAGTGCCGACGCCTCTTATTTA
CAGCAGATGGCGCTGTCATTTATTGCCCTCCGTCTGAATGTTTCATCAGAAACCGTCGATGCCTCACATC
AGGCGCTTCTGCAATATATCCGCCCGGGCGCACAGAACCAGATGAAAGTTATTCTGGCTGAAGAAGCGAA
GCGTATTAAAAACGATAACGTGAACTCAGCCTTTTTCCAGACCAGTGTTCGTGTCTGGCCTCAGTATGGC
CGTGTGGAAATTCGAGGTGTGCTTAAAACCTGGATTGGTGATTCAAAACCTTTCACTGATATCAAACATT
ACATCCTTATTCTGAAGCGGGAAAACGGGGTGACCTGGCTGGATAATTTCGGGGAAACAGACGATGAGAA
AAAATAA
 Primer design