SecReT4
Protein ID: 310286367
T4SS name [ID]Tra_F [106]
Gene symboltraC
Locus tagETN48_p0019
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]11067..13694 [+]
ProductF pilus assembly protein TraC
Component typeTraC_F
UniProt IDE3PYI8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 4.5e-59, Aligned region: 37..277
AAA_10 [PF12846], Evalue: 1.7e-43, Aligned region: 479..772
DUF87 [PF01935], Evalue: 1.6e-05, Aligned region: 482..669
TrwB_AAD_bind [PF10412], Evalue: 5.5e-05, Aligned region: 479..517
Protein Sequence: 875 a.a.     [Download]
>gi|310286367|ref|YP_003937628.1| F pilus assembly protein TraC [Escherichia coli]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|310286349|ref|NC_014615.1|:11067-13694 Escherichia coli plasmid pETN48, complete sequence
GTGAATAACCCACTTGAGGCCGTCACTCAGGCGGTTAACTCCCTCGTCACAGCACTGAAACTGCCTGACG
AATCCGCAAAGGCCAATGAAGTTCTGGGCGAAATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCCGTACCG
TGATTACAACCAGGAATCCGGTCTGTTCATGAATGACACCACGATGGGCTTTATGCTGGAAGCCATCCCC
ATCAATGGGGCGAATGAGTCCATTGTGGAGGCCCTCGATCACATGCTGCGCACCAAACTGCCGCGCGGTA
TTCCGTTGTGTATCCATCTGATGTCCAGTCAGCTGGTTGGTGACAGGATTGAATACGGGCTGCGTGAGTT
CTCCTGGTCAGGTGAACAGGCTGAACGGTTTAACGCCATTACCCGGGCCTATTATATGAAAGCGGCAGCG
ACACAGTTTCCGCTGCCGGAGGGGATGAATCTGCCCCTGACCCTGCGCCATTACCGGGTGTTTATCTCGT
ACTGTTCTCCTTCGAAGAAAAAAAGCCGGGCCGACATTCTGGAAATGGAAAACCTGGTGAAAATCATCCG
GGCGTCGTTACAGGGGGCCAGTATCACCACACAGACGGTGGATGCACAGGCCTTTATCGATATTGTCGGG
GAGATGATTAACCATAACCCGGACTCCCTGTACCCGAAAAGACGTCAGCTGGACCCGTATTCTGATCTGA
ATTATCAGTGTGTGGAGGACAGTTTTGATCTGAAAGTCCGGGCTGATTACCTGACGCTGGGCCTGCGTGA
GAACGGCAGGAACAGCACGGCCCGCATCCTGAATTTCCATCTGGCCCGTAACCCGGAAATCGCCTTCCTG
TGGAACGTGGCCGACAACTACAGCAACCTGCTGAACCCGGAACTGTCCATCTCCTGTCCGTTCATCCTGA
CGCTGACTCTGGTGGTGGAAGACCAGGTGAAAACCCACAGCGAAGCCAACCTGAAGTACATGGACCTGGA
GAAAAAGTCGAAGACCTCCTATGCCAAATGGTTTCCGTCCGTGGAGAAAGAGGCGAAGGAGTGGGGGGAA
CTGCGTCAGCGGCTGGGCTCCGGTCAGTCCTCCGTGGTGTCCTACTTCCTCAACATCACAGCATTCTGCA
AGGACAATAATGAAACGGCGCTGGAAGTGGAGCAGGACATCCTGAACAGCTTTCGTAAAAACGGTTTTGA
GCTGATTTCACCGCGCTTTAACCACATGCGCAATTTCCTGACCTGCCTGCCCTTTATGGCCGGGAAAGGG
CTGTTTAAACAGTTGAAAGAGGCCGGAGTGGTTCAGCGCGCAGAGAGCTTTAATGTTGCCAACCTGATGC
CGTTAGTGGCGGATAACCCCCTGACACCGGCAGGTCTGCTGGCACCCACCTACCGTAACCAGCTGGCGTT
TATCGATATTTTCTTCCGGGGGATGAATAACACCAACTACAACATGGCGGTCTGTGGCACCTCCGGGGCC
GGTAAAACCGGGCTGATACAGCCACTTATCCGCAGCGTGCTGGACTCCGGAGGCTTTGCCGTGGTGTTCG
ACATGGGGGATGGATACAAGTCCCTGTGTGAGAACATGGGCGGGGTGTATCTGGACGGTGAAACCCTGCG
TTTTAACCCGTTTGCGAACATCACCGATATTGACCAGTCAGCGGAGCGTGTCCGTGACCAGTTGTCAGTG
ATGGCCAGCCCCAACGGTAACCTGGATGAAGTGCATGAAGGTCTGCTGTTGCAGGCGGTCAGAGCCTCCT
GGCTGGCCAAAGAGAACAGAGCACGTATTGATGACGTGGTGGATTTCCTGAAAAACGCCAGTGACAGCGA
GCAGTATGCCGAGTCACCGACTATCCGCAGCCGTCTGGACGAAATGATTGTGCTGCTTGACCAGTACACT
GCCAACGGCACTTACGGCCAGTATTTTAACTCTGATGAGCCGTCCCTGCGGGATGACGCAAAAATGGTGG
TGCTGGAGCTGGGCGGACTGGAAGACCGTCCGTCACTGCTGGTTGCGGTGATGTTCTCCCTGATTATCTA
CATCGAGAACAGGATGTACCGCACGCCGCGTAACCTCAAGAAACTGAACGTTATTGATGAAGGCTGGCGT
CTGCTGGACTTCAAAAATCACAAGGTCGGTGAATTTATTGAGAAAGGCTACCGTACGGCCCGCCGTCATA
CCGGTGCCTATATCACCATCACACAGAACATCGTCGACTTTGACTCTGATAAGGCCTCCAGTGCTGCCCG
CGCGGCATGGGGTAACTCCTCCTACAAAATTATCCTCAAACAGAGTGCGAAGGAGTTCGCGAAATACAAC
CAACTGTATCCGGACCAGTTCCTGCCACTGCAGCGCGACATGATTGGTAAGTTTGGTGCGGCCAAAGACC
AGTGGTTCAGTTCCTTCCTGCTGCAGGTGGAAAACCATTCCTCCTGGCACCGTCTGTTTGTGGACCCGTT
AAGCCGCGCCATGTACAGCTCTGACGGCCCGGATTTTGAGTTTGTGCAGCAGAAGCGTAAAGAGGGGCTG
AGTATTCATGAGGCAGTGTGGCAGCTGGCGTGGAAGAAGTCAGGGCCGGAAATGGCTTCGCTGGAAGCCT
GGCTGGAAGAACATGAGAAATACAGGAGTGTGGCATGA
 Primer design