SecReT4
Protein ID: 310286369
T4SS name [ID]Tra_F [106]
Gene symboltraW
Locus tagETN48_p0022
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]14074..14706 [+]
ProductF pilus assembly protein TraW
Component typeTraW_F
UniProt IDP18472, Q7B3W1, B7LI77
KEGG IDecz:pECS88_0079
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 7.6e-11, Aligned region: 1..30
Protein Sequence: 210 a.a.     [Download]
>gi|310286369|ref|YP_003937630.1| F pilus assembly protein TraW [Escherichia coli]
MRCRGLIALLIWGQSVAAADLGTWGDLWPVKEPDMLTVIMQRLTALEQSGEMGRKMDAFKERVIRNSLRP
PAVPGIGRTEKYGSRLFDPSVRLAADIRDNEGRVFARQGEVMNPLQYVPFNQTLYFINGDDPAQVAWMKR
QTPPTLESKIILVQGSIPEMQKSLDSRVYFDQNGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK
 
Nucleotide Sequence: 633 bp     [Download]
>gi|310286349|ref|NC_014615.1|:14074-14706 Escherichia coli plasmid pETN48, complete sequence
ATGAGATGCCGGGGGCTGATTGCCCTGCTGATATGGGGGCAGAGTGTGGCCGCCGCCGATCTTGGTACCT
GGGGCGATCTGTGGCCGGTAAAGGAGCCGGACATGCTGACGGTGATCATGCAGCGCCTGACGGCACTGGA
GCAGTCCGGTGAGATGGGCCGGAAAATGGATGCCTTTAAGGAGCGGGTGATCCGCAACAGTCTGCGGCCC
CCTGCCGTGCCCGGTATCGGACGCACGGAGAAATACGGCAGCCGGTTGTTTGACCCGTCCGTCAGACTGG
CTGCGGATATCCGGGATAACGAAGGGCGGGTGTTTGCCCGTCAGGGTGAAGTGATGAATCCGCTGCAGTA
TGTTCCTTTTAACCAGACGCTGTATTTCATCAATGGCGATGATCCGGCGCAGGTGGCCTGGATGAAACGC
CAGACGCCGCCCACACTGGAGAGCAAAATTATCCTCGTGCAGGGCAGTATCCCGGAGATGCAGAAGTCTC
TGGACAGCCGTGTTTACTTTGACCAGAACGGTGTGCTCTGCCAGCGCCTCGGCATTGATCAGGTCCCGGC
ACGGGTGAGCGCCGTTCCCGGCGATCGCTTCCTGAAGGTGGAATTTATTCCGGCAGAGGAGGGCAGAAAA
TGA
 Primer design