SecReT4
Protein ID: 310286370
T4SS name [ID]Tra_F [106]
Gene symboltraU
Locus tagETN48_p0023
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]14703..15695 [+]
Productconjugal transfer protein TraU
Component typeTraU_F
UniProt IDE3PYJ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 7.5e-84, Aligned region: 29..329
Protein Sequence: 330 a.a.     [Download]
>gi|310286370|ref|YP_003937631.1| conjugal transfer protein TraU [Escherichia coli]
MKRRLWLLMLFLFAGHVPAASADSACEGRFVNPITDICWSCIFPLSLGSIKVSQGKVPDTANPSMPIQIC
PALPPLFRRIGLAIGYWEPMALTDVTRSPGCMVNLGFSLPAFGKTAQGTAKKDEKQVNGAFYHVHWYKYP
LTYWLNIITSLGCLEGGDLDIAYLSEIDPTWTDSSLTTILNPEAVIFANPIAQGACAADAIASAFNMPLD
VLFWCAGSQGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERW
RYQMVNMYPDSGQCHPFGRSVTRWETGKNPPNTKKNFGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|310286349|ref|NC_014615.1|:14703-15695 Escherichia coli plasmid pETN48, complete sequence
ATGAAGCGAAGGCTGTGGCTGCTGATGTTATTCCTTTTCGCCGGTCATGTCCCTGCGGCGTCTGCGGATT
CTGCCTGTGAGGGGCGTTTTGTAAACCCGATCACAGATATCTGCTGGAGCTGTATTTTCCCGCTCTCGCT
GGGCAGTATCAAAGTCAGTCAGGGGAAGGTCCCCGACACGGCGAACCCGTCGATGCCCATTCAGATTTGT
CCGGCACTGCCGCCGCTGTTCAGGCGTATCGGGCTGGCCATTGGTTACTGGGAGCCGATGGCGTTGACGG
ACGTCACCCGGTCACCGGGATGCATGGTGAACCTGGGCTTCAGCCTGCCGGCTTTTGGTAAAACGGCACA
GGGAACGGCGAAAAAGGATGAGAAGCAGGTAAATGGGGCGTTCTATCACGTTCACTGGTACAAATACCCG
CTGACGTACTGGCTGAACATCATCACATCGCTGGGCTGTCTGGAAGGTGGTGACCTGGATATCGCTTATC
TTTCTGAAATCGACCCCACCTGGACGGACAGCAGCCTGACCACCATTCTCAATCCGGAAGCTGTCATCTT
TGCCAATCCGATAGCACAGGGAGCCTGCGCAGCAGATGCGATTGCCAGCGCCTTTAATATGCCTCTCGAT
GTTCTGTTCTGGTGTGCCGGTTCGCAGGGAAGTATGTACCCGTTCAATGGCTGGGTGAGTAATGAGTCCA
GTCCGTTGCAGTCCTCCCTGCTGGTCAGTGAACGCATGGCGTTCAAGCTGCACCGTCAGGGCATGATTAT
GGAAACCATCGGGAAAAATAACGCCGTCTGTAATGAATATCCATCCCCAATCCTGCCCAAAGAACGCTGG
CGTTACCAGATGGTGAATATGTACCCGGACAGCGGACAGTGCCACCCGTTCGGGCGCAGTGTGACCCGCT
GGGAAACCGGGAAAAATCCGCCCAATACAAAGAAAAACTTCGGCTACCTGATGTGGCGTAAACGTAACTG
TGTCTTCCTGTGA
 Primer design