SecReT4
Protein ID: 310286371
T4SS name [ID]Tra_F [106]
Gene symboltrbC
Locus tagETN48_p0024
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]15701..16342 [+]
ProductF pilus assembly protein TrbC
Component typeTrbC_F
UniProt IDE3PYJ2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 4.4e-28, Aligned region: 94..192
Protein Sequence: 213 a.a.     [Download]
>gi|310286371|ref|YP_003937632.1| F pilus assembly protein TrbC [Escherichia coli]
MMKLSMKSLAALLMMLNGAVMASENVNTPENRQFLKQQENLSRQLREKPDHQLKAWAEKQVLETPLQRSD
NHFLDELVRKQQASQDGKPRQGALYFVSFSIPEEGLKRMLGETRHYGIPATLRGMVNNDLKTTAEAVLSL
VKDGATDGVQIDPTLFSQYGIRSVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGD
SGK
 
Nucleotide Sequence: 642 bp     [Download]
>gi|310286349|ref|NC_014615.1|:15701-16342 Escherichia coli plasmid pETN48, complete sequence
ATGATGAAGCTGAGTATGAAATCTCTGGCAGCACTGCTGATGATGCTGAACGGGGCGGTTATGGCGTCAG
AAAACGTGAACACTCCTGAAAACCGCCAGTTCCTGAAGCAGCAGGAAAATTTAAGCAGACAACTGCGTGA
AAAACCTGACCATCAGCTGAAAGCCTGGGCGGAGAAGCAGGTGCTGGAAACCCCCCTTCAGCGTTCAGAT
AACCATTTCCTGGATGAGCTGGTTCGTAAACAGCAGGCTTCGCAGGACGGGAAACCCCGGCAGGGTGCCC
TGTATTTTGTGTCGTTTTCCATTCCCGAAGAGGGGCTGAAACGAATGCTGGGCGAAACCCGGCACTACGG
TATACCCGCCACACTGCGGGGCATGGTGAACAATGACCTGAAGACCACCGCTGAAGCCGTGCTGTCCCTG
GTGAAAGACGGCGCGACTGATGGTGTTCAGATCGACCCGACGCTGTTTTCACAGTACGGCATTCGCAGTG
TACCGGCACTGGTGGTGTTCTGCAGTCAGGGATACGACATCATCCGGGGAAACCTGCGGGTCGGCCAGGC
GCTGGAGAAAGTGGCCGCCACGGGTGACTGCCGGCAGGTGGCTCATGATTTACTGGCAGGGAAAGGAGAT
TCCGGGAAATGA
 Primer design