SecReT4
Protein ID: 310286374
T4SS name [ID]Tra_F [106]
Gene symboltraF
Locus tagETN48_p0027
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]18394..19167 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDB1VCA1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 9.7e-79, Aligned region: 33..247
Protein Sequence: 257 a.a.     [Download]
>gi|310286374|ref|YP_003937635.1| conjugal pilus assembly protein TraF [Escherichia coli]
MKEKVMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQT
ATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSARKAMLAHPELDYNLQYSHYNGTVRNQLAADQ
AQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQR
LGVKYFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 774 bp     [Download]
>gi|310286349|ref|NC_014615.1|:18394-19167 Escherichia coli plasmid pETN48, complete sequence
ATGAAAGAAAAAGTGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTA
TTTTTCCGGCGTCAGGAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGA
AAATAAACCTGTACCTGCAGCCCCCCGTCAGGAACCGGATATTATGCAGAAACTGGCCGCACTGCAGACG
GCAACAAAGCGGGCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGC
TGCAAAATTACTGGACTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAGAAAGGCCATGCTGGCACATCC
TGAACTGGACTATAACCTGCAGTACAGCCATTACAACGGCACGGTACGGAACCAGCTGGCAGCAGACCAG
GCGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTTTTTTACCGGGGGCAGG
ACCCCATCGACGGGCAGCTGGCGCAGGTCATTAATGGCTTCCGGGATACCTATGGTCTGAGTGTTATTCC
CGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGC
CTCGGCGTGAAATATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGTAGTGTTCGTCCGTTATCAT
ACGGTTTTATTTCGCAGGACGACCTGGCAAAACAGTTCCTGAATGTCTCTGAGGATTTTAAACCGAATTT
TTAA
 Primer design