SecReT4
Protein ID: 310286377
T4SS name [ID]Tra_F [106]
Gene symboltraQ
Locus tagETN48_p0030
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]19919..20203 [+]
ProductF pilin synthesis protein TraQ
Component typeTraQ_F
UniProt IDB1VCA4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.2e-49, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|310286377|ref|YP_003937638.1| F pilin synthesis protein TraQ [Escherichia coli]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVHSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMAEQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|310286349|ref|NC_014615.1|:19919-20203 Escherichia coli plasmid pETN48, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGCG
TCTGGTTTCATATCGTCGCCCGTCTTGTTCACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGCTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGCAGAGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design