SecReT4
Protein ID: 310286381
T4SS name [ID]Tra_F [106]
Gene symboltraH
Locus tagETN48_p0034
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]21378..22754 [+]
ProductF pilus assembly protein TraH
Component typeTraH_F
UniProt IDE3PYK2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 4.8e-117, Aligned region: 30..379
Protein Sequence: 458 a.a.     [Download]
>gi|310286381|ref|YP_003937642.1| F pilus assembly protein TraH [Escherichia coli]
MMPRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQPGVWQGQAAGYAYGGSLYARTQVKN
VHLISMTLPDINAGCGGIDAYLGSFSFINSEQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQKM
ASDINSMNLSSCQAAQGIIGGLFPRTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGKSDSVRDKASDK
DKERVTKNINIMWNALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEITPLSARTTDRSIIRAMMEGGTAK
IYHCNDSDKCLKVVADTPVTISRDNALKSQITKLLASIQNKAVSDTPLDDKEKGFISSTTIPVFKYLVDP
QMLGVSNSMIYQLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIEHINDNMNDATRQIAAFQSQVQV
QQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGSTL
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|310286349|ref|NC_014615.1|:21378-22754 Escherichia coli plasmid pETN48, complete sequence
ATGATGCCACGCATTAAACCTCTTCTGGTTCTTTGTGCTGCTTTACTGACGGTCACACCCGCAGCGTCAG
CGGATGTGAACAGCGACATGAATCAGTTCTTTAACAAGCTGGGCTTCGCCTCCAATACCACCCAGCCGGG
CGTCTGGCAGGGGCAGGCCGCCGGCTATGCTTACGGTGGCTCCCTGTATGCCCGTACTCAGGTTAAAAAT
GTTCATCTGATTTCCATGACGCTGCCGGATATCAATGCCGGATGTGGCGGCATCGACGCCTATCTCGGCT
CGTTCAGCTTTATTAATAGCGAGCAGTTGCAGCGTTTTGTTAAGCAGATTATGAGCAATGCTGCCGGTTA
CTTCTTTGACCTTGCCCTGCAGACAACGGTGCCGGAAATCAAAACCGCAAAAGACTTCCTGCAGAAAATG
GCAAGCGACATTAACAGTATGAACCTCAGTTCCTGCCAGGCGGCACAGGGGATTATCGGCGGGCTTTTCC
CCCGGACGCAGGTGTCCCAGCAGAAAGTCTGTCAGGACATTGCCGGTGAGAGCAATATTTTTGCTGACTG
GGCTGCTTCCCGGCAGGGATGTACCGTTGGCGGGAAATCTGACAGCGTCAGGGATAAAGCCAGCGACAAG
GATAAGGAGCGGGTGACCAAAAACATCAACATCATGTGGAATGCGCTTTCCAAAAACAGAATGTTTGACG
GCAACAAAGAGCTGAAAGAGTTTGTGATGACGCTGACCGGCTCACTGGTGTTTGGTCCCAACGGCGAAAT
CACACCGCTATCGGCCAGAACCACTGACCGCTCAATTATCCGGGCCATGATGGAAGGCGGTACAGCAAAA
ATTTATCACTGCAACGATTCTGACAAATGCCTGAAAGTGGTGGCAGACACACCGGTGACCATCAGCCGGG
ATAATGCACTGAAGTCTCAGATTACTAAACTTCTGGCCAGCATTCAGAACAAGGCTGTCAGTGACACGCC
TCTGGATGACAAGGAAAAAGGCTTTATTTCCAGTACCACCATCCCCGTCTTCAAATACCTGGTTGACCCG
CAGATGCTCGGTGTTTCCAACAGTATGATTTACCAGCTGACGGACTATATCGGTTACGACATCCTGCTGC
AGTACATTCAGGAGCTGATACAGCAGGCCCGGGCGATGGTGGCCACGGGAAATTATGACGAAGCAGTTAT
CGAACATATTAACGACAATATGAATGATGCCACCCGGCAGATTGCGGCGTTTCAGTCACAGGTACAGGTG
CAGCAGGATGCGCTGCTGGTCGTCGATCGTCAGATGAGCTACATGCGTCAGCAGCTTTCCGCCCGCATGC
TCAGTCGTTACCAGAACAACTATCACTTCGGAGGGAGCACGCTGTGA
 Primer design