SecReT4
Protein ID: 310286382
T4SS name [ID]Tra_F [106]
Gene symboltraG
Locus tagETN48_p0035
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]22751..25576 [+]
Productmating contact stabilization protein TraG
Component typeTraG_F
UniProt IDE3PYK3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4.8e-125, Aligned region: 3..450
Protein Sequence: 941 a.a.     [Download]
>gi|310286382|ref|YP_003937643.1| mating contact stabilization protein TraG [Escherichia coli]
MNEVYVIAGGEWLRNNLNAIAAFMGTRTWDSIEKIALTLSVVAVAFMWVQRHNVMDLLGWAAVFVLISLL
VNIRTSVQIIDNSDLVKVHRVDNVPVGLAMPLSLTTRIGHAMVASYEMIYTQPDSFTYSKTGMLFGAELV
SKSTDFLSRNPEIANLFQDYVQNCVMGDIYLNHKYTLEELMASNDPYTLIFSRPSPLRGVYDSNNNFVTC
KDASVSLKDKLNLDTQSGGKTWHYYAQQLFGGRPDPNLLFSTLIGDSYRYFYDSSKSASQIIRQNVTINA
LKEGITSYAARNGDSASLVNLATTSSMEKQRLAHVSIGHVAMRTLPMTQTILTGIAIGIFPLLVLAAVFN
KLTLSVLKGYVFALMWLQSWPMLYAILNSAMTFYAKQNGAPVVLSEISQIQLKYSDLASTAGYLSMMIPP
LSWMMVRGLGAGFSSVYSHFASSAISPTASAAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQT
GSGATTTQTRDGNMVMDASGAMSRLPVGINATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNSLSQ
FGSNRGSSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATQELASTSTRLSGGMYADAHAE
WGVKPKILGVGGGVGIRGGFKGSLDATDDDSHSASSGSRATHDARHDIDARATQDFKEASDYFTSRKVSE
SGSHTDNNADSREDQLSAALNSAKQSYDQYTTNMTRSHEYAEMASRTESMSGQMSEDLSQQFAQYVMKHA
PQDAEAILTNTSSPEIAERRRAMAWSFVQEQVQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIADHQGH
QAIIDQRTQDSNIRNDVKHQVDNMVTEYKGNIGDTQNSIHGEENIVDRQYSELKNNHKQEEIQQNNRYNE
ENKRQKLIPTPSEDALKQMVDDKKERLKGPL
 
Nucleotide Sequence: 2826 bp     [Download]
>gi|310286349|ref|NC_014615.1|:22751-25576 Escherichia coli plasmid pETN48, complete sequence
GTGAATGAAGTTTATGTGATTGCCGGTGGTGAATGGTTGCGGAATAACCTGAACGCCATTGCCGCCTTTA
TGGGAACCAGGACGTGGGATTCCATTGAAAAAATTGCTCTCACCCTGTCTGTTGTTGCGGTGGCCTTTAT
GTGGGTACAGCGCCATAACGTGATGGATTTGCTGGGCTGGGCGGCGGTGTTTGTACTTATCAGCCTGCTG
GTTAATATCCGTACGTCGGTGCAGATTATTGATAACAGTGACCTGGTCAAAGTCCATCGGGTGGATAATG
TGCCGGTCGGACTGGCGATGCCACTTTCACTGACGACCCGTATCGGGCATGCAATGGTGGCCAGTTACGA
GATGATCTACACGCAACCGGACAGTTTCACCTACAGCAAAACGGGGATGCTGTTTGGCGCAGAACTGGTA
TCAAAAAGCACCGACTTTTTGTCCCGCAATCCGGAAATCGCCAATCTTTTTCAGGATTATGTGCAGAACT
GTGTGATGGGGGATATTTACCTGAACCACAAATACACGCTGGAGGAGCTGATGGCCTCCAATGATCCCTA
CACGCTGATTTTTTCCCGCCCCAGTCCGCTGCGGGGCGTTTATGACAGCAATAATAATTTCGTGACCTGT
AAGGACGCGTCGGTTTCGCTGAAAGACAAGCTGAATCTGGACACACAGAGTGGCGGAAAAACCTGGCATT
ATTATGCCCAGCAGTTATTTGGTGGTCGCCCTGATCCGAACCTGTTGTTCAGTACGCTGATTGGCGACAG
TTACCGTTACTTCTATGACTCAAGTAAATCAGCCAGCCAGATCATCCGCCAGAATGTCACCATTAATGCG
CTGAAGGAGGGGATCACCAGTTATGCAGCACGTAATGGTGACTCAGCCAGCCTGGTGAATCTGGCCACCA
CGTCATCGATGGAGAAGCAACGTCTGGCACATGTCTCCATCGGTCATGTGGCGATGCGGACACTGCCCAT
GACGCAGACCATCCTGACGGGGATCGCCATCGGTATTTTCCCGCTCCTGGTACTGGCGGCTGTCTTCAAC
AAACTGACGCTGTCTGTCCTGAAAGGCTATGTGTTTGCCCTGATGTGGTTGCAGTCATGGCCAATGTTGT
ATGCCATTCTGAACAGCGCCATGACATTTTATGCGAAGCAGAATGGTGCACCGGTGGTGCTCTCGGAAAT
TTCACAGATACAGCTGAAATACTCCGATCTGGCTTCCACTGCCGGGTATCTTTCCATGATGATCCCGCCA
TTATCCTGGATGATGGTCAGGGGACTCGGGGCCGGATTTTCCAGTGTGTACAGCCATTTCGCTTCCTCTG
CTATCAGCCCGACCGCCAGTGCGGCAGGCAGTGTGGTTGACGGTAATTACTCCTACGGCAACATGCAGAC
GGAAAACGTGAACGGCTTCAGCTGGAGCACCAACAGCACCACGTCGTTTGGTCAGATGATGTACCAGACC
GGCAGTGGTGCAACCACCACACAGACCCGTGACGGTAATATGGTGATGGATGCAAGCGGAGCGATGTCCC
GGTTACCGGTTGGTATCAATGCAACGCGTCAGATTGCAGCGGCACAACAGGAAATGGCCCGGGAGGCATC
GAACAGAGCAGAAAGCGCCCTGCATGGGTTCAGCAGCAGTATTGCCAGTGCCTGGAACTCGCTCAGTCAG
TTTGGTTCTAACCGGGGGAGCAGTGATTCTGTCACAGGTGGTGCTGACAGCACGATGAGCGCACAGGATT
CCATGATGGCCAGCCGTATGCGCAGTGCAGTGGAAAGCTATGCGAAGGCGCATAATATCAGTAATGAGCA
GGCGACTCAGGAACTGGCATCAACAAGTACCAGGCTATCTGGTGGAATGTATGCTGATGCTCATGCTGAA
TGGGGGGTTAAACCTAAAATTCTTGGTGTTGGTGGTGGGGTAGGCATCAGAGGTGGATTTAAGGGGAGCT
TGGATGCAACGGATGATGACTCACATTCAGCAAGTAGTGGCAGCAGGGCTACCCATGATGCTCGCCATGA
TATCGATGCCAGAGCTACACAAGACTTTAAAGAGGCCAGCGATTACTTTACCAGTCGCAAAGTCAGTGAA
TCCGGCAGCCATACTGACAATAATGCTGATTCCCGTGAGGACCAGCTGTCTGCAGCCCTGAATTCAGCGA
AACAGAGTTACGATCAGTACACGACGAATATGACCCGCAGCCATGAATATGCTGAAATGGCATCCCGTAC
TGAAAGCATGAGTGGGCAGATGAGTGAAGATCTGTCGCAACAGTTTGCACAGTATGTGATGAAACACGCA
CCGCAGGATGCCGAAGCTATTCTGACAAACACCAGTTCACCGGAGATTGCAGAACGCCGTCGGGCGATGG
CATGGTCTTTTGTTCAGGAACAGGTGCAGCCTGGTGTTGATAATGCCTGGCGTGAATCCCGTGGGGATAT
TGGTAAAGGAATGGAGAGCGTACCTTCGGGTGGTGGCAGCCAGGATATTATTGCTGACCATCAGGGGCAT
CAGGCCATTATTGATCAAAGAACGCAGGACAGTAATATCCGTAATGATGTAAAACATCAGGTTGATAATA
TGGTCACAGAATATAAAGGGAATATCGGAGATACTCAGAATAGTATTCATGGCGAAGAAAATATTGTAGA
CAGACAATATTCAGAGTTAAAAAATAATCACAAACAGGAAGAAATTCAACAAAACAACAGATATAATGAA
GAAAATAAACGACAGAAATTAATACCAACACCGTCTGAAGATGCGTTAAAACAGATGGTGGATGATAAGA
AAGAACGATTGAAGGGGCCATTATGA
 Primer design