SecReT4
Protein ID: 310286385
T4SS name [ID]Tra_F [106]
Gene symboltraD
Locus tagETN48_p0038
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]27079..29259 [+]
Productconjugal transfer coupling protein TraD
Component typeTraD_F
UniProt IDE3PYK6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 2.7e-148, Aligned region: 172..561
TraD_N [PF12615], Evalue: 1.6e-33, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 1e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 7.6e-11, Aligned region: 187..491
T4SS-DNA_transf [PF02534], Evalue: 7.7e-08, Aligned region: 382..476
Protein Sequence: 726 a.a.     [Download]
>gi|310286385|ref|YP_003937646.1| conjugal transfer coupling protein TraD [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDDKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
KRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRKRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQIASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PQQPVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDTQQ
QMQRREEVNINVHRERGEDVEPGDDF
 
Nucleotide Sequence: 2181 bp     [Download]
>gi|310286349|ref|NC_014615.1|:27079-29259 Escherichia coli plasmid pETN48, complete sequence
ATGAGTTTTAACGCAAAGGATATGACCCAGGGCGGTCAGATTGCGTCCATGCGTATCCGCATGTTCAGCC
AGATCGCCAATATCATGCTTTACTGCCTGTTTATTTTTTTCTGGATACTCGTTGGTCTGGTTTTATGGGT
AAAAATAAGCTGGCAGACGTTTGTGAACGGCTGTATTTACTGGTGGTGTACCACGCTGGAAGGCATGCGG
GATTTAATCAAGTCCCAGCCGGTATATGAGATCCAGTATTACGGCAAAACCTTCCGGATGAACGCTGCTC
AGGTACTGCATGATAAATATATGATTTGGTGCGGAGAGCAGCTATGGTCCGCATTCGTTCTGGCCACAGT
TGTGGCACTGGTTATTTGCCTGATTACCTTCTTTGTTGTCTCCTGGATTCTGGGGCGTCAGGGTAAACAA
CAGAGCGAAAATGAAGTCACAGGTGGTCGTCAGCTGACAGACAATCCGAAAGACGTTGCCCGGATGCTGA
AAAAAGACGACAAGGACTCCGATATCCGGATTGGCGACCTGCCGATTATCCGGGATTCTGAAATCCAGAA
CTTCTGTCTGCACGGCACGGTCGGGGCCGGTAAGTCGGAAGTTATCCGTCGTCTGGCCAACTACGCCCGT
AAGCGCGGTGATATGGTGGTGATTTATGACCGTTCAGGGGAATTTGTTAAAAGTTACTATGATCCCTCCA
TCGATAAAATCCTGAATCCGCTGGATGCCCGCTGTGCCGCATGGGATTTATGGAAGGAGTGTCTGACACA
GCCGGATTTTGATAATACGGCAAATACCCTGATCCCGATGGGCACAAAAGAGGACCCGTTCTGGCAGGGT
TCAGGACGTACCATTTTTGCGGAAGCGGCGTACCTGATGCGTAATGACCCCAACCGCAGCTACAGCAAAC
TGGTGGACACTCTGCTTTCCATCAAAATCGAAAAACTGCGTACCTTCCTGCGTAATTCACCGGCGGCCAA
CCTGGTGGAAGAGAAAATCGAGAAAACGGCGATTTCCATCCGTGCTGTGCTGACCAACTACGTGAAAGCC
ATCCGTTACCTGCAGGGGATTGAGCATAACGGTGAGCCCTTCACCATCCGTGACTGGATGCGTGGTGTCC
GGGAAGATCAGAAAAACGGCTGGCTGTTTATCTCATCGAACGCCGACACCCATGCCTCCCTGAAGCCGGT
GATCTCCATGTGGCTGTCCATTGCCATTCGTGGTCTGCTGGCAATGGGAGAAAACCGTAAACGTCGTGTG
TGGTTTTTCTGTGACGAGTTACCCACGTTACACAAACTGCCTGACCTGGTGGAGATCCTGCCGGAAGCCC
GTAAGTTCGGTGGCTGTTATGTGTTTGGTATCCAGTCCTATGCCCAGCTGGAAGATATCTACGGTGAGAA
AGCGGCTGCCACGTTGTTTGACGTCATGAACACCCGTGCCTTTTTCCGTTCTCCCAGCCATAAGATTGCA
GAGTTCGCTGCCGGTGAGATTGGTGAGAAAGAGCACCTGAAAGCCAGCGAGCAGTATTCCTACGGTGCTG
ATCCGGTACGTGACGGGGTATCGACCGGTAAGGATATGGAGCGCCAGACGCTGGTCAGTTATTCCGACAT
TCAGTCTCTGCCGGATCTGACCTGTTATGTCACCCTGCCCGGACCGTATCCGGCAGTAAAACTCTCTCTG
AAATATCAGACACGACCGAAGGTCGCTCCGGAGTTTATTCCGCGTGACATCAACCCGGAAATGGAGAACC
GCCTGAGTGCCGTACTTGCCGCAAGGGAAGCAGAAGGTCGTCAGATAGCCAGCCTCTTCGAACCGGATGT
CCCGGAGGTTGTTTCCGGAGAAGACGTGACTCAGGCTGAACAGCCGCAACAGCCGCAACAGCCGCAACAG
CCGCAACAGCCGGTGTCTCCTGCCATCAACGATAAGAAGTCAGATTCAGGTGTGAATGTTCCGGCAGGGG
GGATCGAGCAGGAGCTGAAAATGAAACCGGAAGAAGAGATGGAACAGCAACTGCCACCCGGGATCAGTGA
ATCCGGTGAAGTGGTGGATATGGCCGCTTATGAGGCATGGCAACAGGAAAATCATCCGGACACCCAGCAG
CAGATGCAGCGTCGTGAAGAGGTGAACATTAATGTGCACCGGGAGCGCGGGGAGGATGTTGAGCCGGGAG
ATGATTTCTGA
 Primer design