SecReT4
Protein ID: 310286386
T4SS name [ID]Tra_F [106]
Gene symboltraI
Locus tagETN48_p0039
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]29259..34379 [+]
Productprotein TraI (DNA helicase I)
Component typeTraI_F
UniProt IDE3PYK7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 3.6e-87, Aligned region: 7..287
TraI [PF07057], Evalue: 4.8e-59, Aligned region: 1434..1560
AAA_30 [PF13604], Evalue: 2.4e-40, Aligned region: 968..1156
AAA_19 [PF13245], Evalue: 1.4e-05, Aligned region: 982..1047
UvrD_C_2 [PF13538], Evalue: 1.9e-05, Aligned region: 1341..1444
Protein Sequence: 1706 a.a.     [Download]
>gi|310286386|ref|YP_003937647.1| protein TraI (DNA helicase I) [Escherichia coli]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIRETVGEDASLKSRDVAALDTRKSKQHVDPEIKMTEWMQT
LKETGFDIRAYRDAAEQRAYTRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
AGVIERARAGIDEAISREQLIPLDREKGMFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELAMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKYAGVNTYRW
QGGEQRPATIISEPDRNVRYDRLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVADSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETSLETAISLQKTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVEKALSGLESVKPSQVPRLEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGVT
LYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGRSAG
IWLNPLTTDDGNGLRGFSGEGRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRE
TERRADEIVRKMAENKPDLPDGKTELAVRDIAGQERDRTATSERETALPESVLRESQREREAVREVAREN
LLQRLLQQMERDMVRDLQKEKTLGGD
 
Nucleotide Sequence: 5121 bp     [Download]
>gi|310286349|ref|NC_014615.1|:29259-34379 Escherichia coli plasmid pETN48, complete sequence
ATGATGAGTATCGCACAGGTCAGATCGGCCGGAAGTGCCGGTAACTATTATACCGACAAGGATAATTACT
ATGTACTGGGCAGCATGGGAGAACGCTGGGCCGGCAGGGGGGCTGAACAGCTGGGACTGCAGGGCAGTGT
CGATAAGGATGTTTTTACCCGTCTTCTGGAGGGAAGGCTGCCGGACGGAGCGGATCTAAGCCGCATGCAG
GATGGCAGTAATAAGCATCGTCCCGGCTACGACCTGACCTTCTCCGCCCCCAAAAGTGTCTCCATGATGG
CCATGTTAGGTGGCGATAAGCGCCTGATTGATGCACATAACCAGGCCGTGGACTTTGCTGTTCGTCAGGT
GGAGGCGCTGGCCTCCACACGGGTGATGACGGACGGACAGTCAGAAACGGTACTGACCGGTAATCTGGTG
ATGGCACTGTTTAACCACGACACCAGTCGCGATCAGGAACCACAGTTACACACGCATGCGGTGGTAGCTA
ATGTCACGCAGCATAACGGTGAGTGGAAGACACTGAGCAGTGACAAAGTGGGGAAAACGGGGTTCATTGA
GAATGTGTACGCTAATCAGATTGCCTTTGGCAGGCTCTACCGGGAAAAACTGAAAGAGCAGGTTGAGGCG
CTGGGCTATGAAACGGAAGTGGTGGGTAAGCACGGTATGTGGGAAATGCCGGGCGTACCGGTGGAGGCCT
TTTCCGGACGCTCACAGACTATCCGGGAGACCGTCGGGGAGGACGCCTCGCTGAAATCCCGGGATGTGGC
GGCGCTGGATACGCGTAAATCCAAACAGCACGTCGATCCTGAAATCAAAATGACCGAGTGGATGCAGACG
CTGAAGGAAACCGGGTTCGATATCCGGGCGTATCGTGACGCAGCGGAACAACGGGCATATACCCGCACGC
AGACACCCGGACCAGCTTCACAGGACGGGCCGGATGTGCAGCAGGCGGTGACACAGGCGATTGCCGGATT
AAGTGAACGCAAAGTGCAGTTTACGTACACGGACGTGCTGGCCAGGACGGTCGGCATACTGCCGCCGGAA
GCCGGTGTGATTGAGCGGGCACGCGCCGGTATCGATGAGGCCATCAGCCGTGAGCAGCTTATCCCCCTCG
ATCGTGAGAAGGGGATGTTCACGTCCGGGATTCATGTGCTCGATGAGCTGTCAGTCCGGGCACTCAGTCG
TGACATCATGAAACAGAACCGGGTGACCGTACATCCGGAGAAAAGTGTCCCCCGGACGGCCGGTTACAGC
GATGCCGTCAGTGTTCTGGCACAGGATCGCCCGTCGCTGGCCATTGTGTCCGGGCAGGGCGGTGCAGCCG
GGCAGCGTGAGCGGGTGGCTGAACTGGCAATGATGGCCCGGGAGCAGGGGCGGGAGGTGCAGATTATCGC
CGCTGACCGTCGCTCGCAGATGAACCTGAAGCAGGATGAACGGCTGTCCGGTGAGCTGATAACCGGACGT
CGTCAGCTGCAGGAGGGCATGGCCTTCACGCCGGGCAGTACCGTTATCGTCGACCAGGGCGAAAAACTCT
CCCTGAAAGAGACGTTAACCCTGCTGGACGGTGCCGCACGTCATAACGTACAGGTCCTGATAACCGACAG
CGGGCAGCGAACCGGTACAGGCAGTGCGCTGATGGCCATGAAGTATGCCGGGGTGAACACGTATCGCTGG
CAGGGCGGAGAACAGCGACCGGCAACCATCATCAGTGAACCGGACCGGAATGTCCGCTATGACCGGCTGG
CCGGAGATTTTGCGGCCAGCGTGAAAGCCGGAGAAGAGAGCGTGGCACAGGTCAGCGGGGTACGGGAACA
GGCCATACTGACACAGGCCATTCGCAGTGAGCTGAAAACACAGGGCGTGCTCGGACACCCGGAGGTGACC
ATGACCGCCCTGTCACCGGTCTGGCTGGACAGCCGGAGCCGTTATCTGCGGGATATGTACCGACCGGGGA
TGGTGATGGAGCAGTGGAACCCGGAGACACGCAGTCATGACCGCTATGTTATCGACCGGGTGACGGCGCA
GAGTCACAGCCTGACCCTGCGGGATGCGCAGGGCGAAACGCAGGTGGTGCGTATTTCCTCCCTGGACAGC
AGCTGGTCGCTGTTCCGGCCGGAAAAAATGCCGGTGGCAGACGGCGAGCGACTGAGGGTGACAGGGAAAA
TTCCCGGACTCCGCGTCTCCGGCGGTGACCGCCTGCAGGTGGCATCCGTCAGTGAAGATGCGATGACGGT
TGTTGTGCCGGGGCGGGCTGAACCGGCCACCCTGCCTGTGGCTGATTCACCGTTCACGGCACTGAAGCTG
GAGAACGGCTGGGTGGAAACGCCCGGGCATTCCGTCAGTGACAGTGCGACGGTGTTTGCCTCCGTCACAC
AGATGGCAATGGACAACGCCACCCTGAACGGTCTGGCCCGCAGCGGTCGTGATGTCCGGCTGTATTCCTC
ACTGGATGAAACCCGTACTGCGGAAAAACTTGCCCGCCATCCCTCCTTTACGGTGGTTTCTGAGCAGATA
AAGGCGCGGGCCGGTGAGACATCGCTGGAAACCGCTATCAGTCTGCAGAAAACCGGGCTGCACACGCCGG
CACAGCAGGCCATTCATCTGGCCCTTCCTGTGCTGGAAAGTAAAAACCTGGCCTTCAGCATGGTGGACCT
GCTGACAGAGGCGAAGTCGTTTGCTGCAGAAGGAACCGGTTTTACTGAACTGGGAGGGGAAATCAATGCG
CAGATAAAACGCGGTGACTTACTGTATGTGGATGTGGCAAAAGGCTATGGCACAGGCCTGCTGGTTTCCC
GTGCGTCGTATGAGGCAGAAAAAAGTATTCTTCGCCATATTCTCGAAGGTAAGGAGGCGGTCACGCCGCT
GATGGAGAGAGTACCCGGCGAACTCATGGAGACGTTAACGTCGGGACAGCGTGCCGCCACCCGTATGATA
CTGGAAACGTCCGACCGTTTCACGGTGGTACAGGGTTATGCCGGGGTGGGTAAGACCACACAGTTCCGGG
CGGTGATGTCAGCCGTGAACATGCTGCCGGAGAGTGAGCGTCCCCGTGTCGTTGGGCTGGGGCCCACGCA
CCGTGCGGTCGGGGAGATGCGCAGCGCCGGCGTGGATGCACAGACACTGGCGTCCTTTCTGCATGACACG
CAGCTGCAGCAGCGCAGCGGAGAAACGCCGGATTTCAGCAACACGCTGTTCCTGCTCGATGAGAGCTCAA
TGGTGGGCAATACCGACATGGCACGGGCATACGCCCTGATTGCGGCCGGTGGCGGTCGTGCTGTGGCCAG
CGGTGACACGGACCAGCTGCAGGCCATCGCGCCCGGTCAGCCTTTCCGTCTCCAGCAGACGCGCAGTGCT
GCCGATGTGGCCATCATGAAGGAGATTGTGCGTCAGACGCCGGAACTGCGGGAGGCGGTATACAGCCTGA
TTAACCGGGATGTGGAAAAGGCACTGTCCGGGCTTGAGAGTGTGAAACCGTCTCAGGTGCCACGTCTGGA
GGGCGCATGGGCACCGGAGCACTCCGTGACGGAGTTCAGTCACAGCCAGGAAGCGAAACTGGCAGAAGCG
CAGCAGAAGGCGATGCTGAAAGGCGAGGCTTTCCCGGATATCCCCATGACACTGTATGAAGCCATTGTCC
GCGACTATACCGGCAGGACACCGGAAGCACGGGAGCAGACGCTGATTGTCACGCACCTGAATGAGGACCG
GCGCGTACTGAACAGCATGATTCATGATGCACGGGAAAAGGCCGGTGAGCTGGGGAAAGAGCAGGTCATG
GTGCCTGTCCTGAACACAGCGAATATACGTGACGGGGAGCTGCGTCGTCTCTCCACCTGGGAGAATAACC
CGGATGCCCTTGCCCTGGTGGATAGTGTGTATCACCGGATTGCCGGTATCAGCAAGGATGACGGGCTGAT
AACCCTGGAGGATGCGGAAGGTAACACGCGGCTGATTTCGCCCCGGGAGGCGGTGGCTGAAGGTGTCACA
CTGTACACCCCGGACAAAATCCGGGTGGGGACCGGCGACCGGATGCGCTTCACGAAGAGTGACCGGGAGC
GCGGTTATGTGGCCAACAGCGTCTGGACGGTGACAGCGGTTTCCGGTGACAGTGTCACGCTGTCAGACGG
ACAGCAGACCCGGGTGATTCGCCCCGGCCAGGAGCGGGCAGAGCAACATATTGACCTGGCTTATGCCATC
ACCGCCCACGGTGCGCAGGGGGCGAGTGAAACCTTTGCCATCGCGCTTGAAGGCACGGAAGGTAACCGGA
AACTGATGGCCGGCTTTGAGTCAGCCTACGTGGCCCTGTCGCGTATGAAGCAGCATGTGCAGGTGTACAC
CGATAACCGTCAGGGCTGGACGGATGCCATTAACAATGCCGTACAGAAAGGAACTGCCCACGATGTGCTG
GAGCCGAAACCGGACCGGGAGGTCATGAATGCGCAGCGGCTGTTCAGTACGGCACGGGAACTGCGGGACG
TGGCGGCAGGCCGTGCCGTTCTCCGTCAGGCGGGGCTGGCCGGGGGAGACAGTCCTGCACGGTTTATTGC
TCCGGGACGTAAATATCCGCAACCGTATGTGGCACTGCCGGCTTTTGACCGTAACGGCAGGTCCGCCGGT
ATCTGGCTGAACCCACTGACCACGGATGACGGAAACGGGCTGCGGGGATTCAGCGGTGAAGGCCGTCCGT
GGAATCCCGGTGCCATCACCGGTGGCCGCGTGTGGGGGGATATTCCGGATAACAGCGTCCAGCCGGGAGC
CGGAAATGGTGAACCGGTCACGGCAGAGGTACTGGCACAGCGGCAGGCTGAAGAGGCCATCCGCCGTGAA
ACGGAACGCCGCGCAGATGAAATTGTCAGGAAAATGGCAGAGAACAAACCTGACTTGCCGGACGGCAAAA
CAGAGCTGGCTGTCAGGGATATTGCCGGGCAGGAACGTGACCGGACTGCCACTTCTGAACGGGAAACCGC
ACTGCCGGAGAGTGTGCTGCGTGAATCACAACGGGAACGGGAAGCGGTCCGGGAGGTTGCCCGGGAAAAT
CTGCTGCAGAGGCTTCTGCAGCAGATGGAGCGGGATATGGTTCGTGACCTGCAGAAAGAGAAAACCCTGG
GCGGAGACTGA
 Primer design