SecReT4
Protein ID: 310286387
T4SS name [ID]Tra_F [106]
Gene symboltraX
Locus tagETN48_p0040
StrainEscherichia coli plasmid pETN48 (NC_014615)
Repliconplasmid pETN48 [GenBank: NC_014615] [Browse all T4SS(s) in this replicon]
Location [Strand]34342..35145 [+]
ProductF pilin acetylase traX
Component typeTraX_F
UniProt IDE3PYK8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.6e-52, Aligned region: 51..266
Protein Sequence: 267 a.a.     [Download]
>gi|310286387|ref|YP_003937648.1| F pilin acetylase traX [Escherichia coli]
MTCRKRKPWAETDTGRQTLMTTDNTNTIRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINL
IFQLKQEWMFLVGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFA
VVAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLMLAVSHRLYRAEDRAERLALVACLLAVIP
ALNLATSDAAAVAGLVMTVLTVGLVSCAGKSLPRFWPGDFFPTFYACHLAVLGVLAL
 
Nucleotide Sequence: 804 bp     [Download]
>gi|310286349|ref|NC_014615.1|:34342-35145 Escherichia coli plasmid pETN48, complete sequence
GTGACCTGCAGAAAGAGAAAACCCTGGGCGGAGACTGATACAGGAAGACAAACACTGATGACAACGGATA
ACACGAACACGATACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGTCATTTCTGGTCTG
GTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTACTGGACCACATCAATCTG
ATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGTCGGGCGTGGGGCCTTTCCGCTTTTTGCCCTGGTGT
GGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGTGGGGATGGGGAAT
TATTGCCCAGTTCGCATATTATCTGGCAGGCTTTCCCTGGTATGAGGGGAATATCCTGTTTGCCTTTGCA
GTGGTGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCGGCCATTCTCCTGA
TGGCCCTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGCTGGCAGTCAGCCA
CCGGCTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGGTCGCCTGCCTGCTGGCTGTTATTCCG
GCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCTGGTCTTGTGATGACGGTGCTGACCGTTGGTC
TGGTGTCGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGAGACTTTTTCCCGACGTTCTATGCCTG
TCATCTGGCTGTGCTGGGCGTTCTGGCGCTGTGA
 Primer design