SecReT4
Protein ID: 310639236
T4SS name [ID]Trb [286]
Gene symbol-
Locus tagEIO_2886
StrainKetogulonicigenium vulgare Y25
Repliconplasmid pYP1 [GenBank: NC_014621] [Browse all T4SS(s) in this replicon]
Location [Strand]13648..13875 [+]
ProductConjugal transfer protein TrbC
Component typeTrbC
UniProt IDE3F4R2
KEGG IDkvu:EIO_2886
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.3e-19, Aligned region: 1..65
Protein Sequence: 75 a.a.     [Download]
>gi|310639236|ref|YP_003943995.1| Conjugal transfer protein TrbC, partial [Ketogulonicigenium vulgare Y25]
MPWEAPLQSILQSIEGPVAKIIAVIVIIATGLALAFGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFG
GGALI
 
Nucleotide Sequence: 228 bp     [Download]
>gi|310639221|ref|NC_014621.1|:13648-13875 Ketogulonicigenium vulgare Y25 plasmid pYP1, complete sequence
ATGCCGTGGGAGGCGCCGCTTCAGAGCATCCTTCAGTCGATCGAAGGGCCGGTCGCCAAGATCATTGCGG
TAATCGTCATCATCGCCACCGGCCTGGCGCTGGCCTTCGGCGATACCTCGGGCGGTTTCCGCCGCCTGAT
CCAGATCGTCTTCGGCCTCAGCATAGCCTTCGCCGCCAGCTCCTTCTTCCTGTCGTTCTTCTCGTTCGGC
GGCGGGGCGCTCATCTGA
 Primer design