SecReT4
Protein ID: 310639241
T4SS name [ID]Trb [286]
Gene symbol-
Locus tagEIO_2891
StrainKetogulonicigenium vulgare Y25
Repliconplasmid pYP1 [GenBank: NC_014621] [Browse all T4SS(s) in this replicon]
Location [Strand]17713..19080 [+]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDE3F4R7
KEGG IDkvu:EIO_2891
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.2e-55, Aligned region: 37..262
Protein Sequence: 455 a.a.     [Download]
>gi|310639241|ref|YP_003944000.1| P-type conjugative transfer protein TrbL [Ketogulonicigenium vulgare Y25]
MGGTGVIDNFLGVFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWSWGADDDIIARLVKKTLFVGVF
AYLIGNWNNLAQIIFDSFAGLGLKGSGTGFSAADLLRPGKVAQTGLDAGRPLLESISDMMGYWSFFENFI
QIACLMFAWVLVLLAFFILAVQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVLVL
AVIIGIGSTLFSQFTAGFGGVTPTIDDAMAIVLAALSLLGLGIFGPGIASGLVSGGPQLGAGAAVGTGLA
AGGMMLAGGAAAGMAAKGGAAALSGGAAAVRGGAAAAGAVSAAYSVGSLGQSGAAGVASGLGGVARAAGS
AAASPLKRAASKASESIKSSFSDGARAGFGVSGGSSTAGTVGGAGEAASAAASPAAQAGGSPAWARQMQR
KQTLSHGTSMAAHAVRSGDSHGGGSSINLSESDRS
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|310639221|ref|NC_014621.1|:17713-19080 Ketogulonicigenium vulgare Y25 plasmid pYP1, complete sequence
ATGGGCGGCACCGGCGTCATCGACAATTTCCTGGGAGTCTTCACCAGCTACATCGACAGTGGCTTCGGTT
TGCTTGGAGGTGAAGTCGCCTTCATCGCCACCACGCTGATCGTCATCGACGTGACGCTGGCGGCATTATT
CTGGTCCTGGGGTGCAGATGACGACATCATCGCCCGGCTGGTCAAGAAAACGCTGTTCGTGGGCGTCTTC
GCCTATCTGATCGGCAACTGGAACAATCTCGCGCAGATCATCTTCGACAGCTTTGCGGGTCTGGGCCTCA
AGGGGTCGGGCACCGGCTTTTCCGCCGCCGATCTGCTGCGGCCCGGCAAGGTGGCGCAGACCGGCCTTGA
TGCCGGTCGCCCGCTGCTCGAATCCATCTCCGACATGATGGGCTACTGGTCGTTCTTCGAGAACTTCATC
CAGATCGCCTGCCTGATGTTCGCCTGGGTGCTGGTGCTGCTCGCCTTCTTCATTCTCGCCGTGCAGCTCT
TCGTCACGCTGATCGAGTTCAAGCTGACCACGCTGGCCGGTTTTGTGCTGATCCCCTTCGGCCTGTTCGG
CAAGACCGCCTTCATGGCCGAGCGCGTTCTCGGCAATGTCGTGTCCTCCGGCATCAAGGTGCTGGTTCTG
GCCGTCATCATCGGTATCGGCTCGACGCTGTTTTCACAGTTCACGGCAGGCTTCGGCGGCGTGACGCCGA
CCATTGACGATGCCATGGCAATCGTGCTGGCGGCCCTTTCCCTTCTCGGCCTCGGCATATTCGGTCCCGG
CATCGCTTCCGGTCTCGTTTCCGGCGGCCCGCAGCTTGGCGCAGGTGCCGCCGTTGGAACCGGCCTTGCC
GCAGGCGGCATGATGCTTGCCGGGGGTGCCGCCGCAGGGATGGCCGCGAAGGGAGGAGCCGCTGCGCTCT
CTGGTGGAGCGGCTGCCGTTCGGGGTGGTGCCGCCGCCGCAGGTGCGGTGAGCGCCGCCTACAGTGTCGG
TTCACTTGGCCAGTCCGGCGCTGCCGGTGTCGCCTCCGGTCTGGGCGGTGTTGCCCGTGCGGCAGGCTCC
GCCGCCGCATCGCCCCTGAAGCGCGCGGCTTCCAAAGCCTCCGAAAGCATCAAGTCCAGCTTTTCTGATG
GAGCGCGCGCCGGTTTCGGCGTCAGTGGCGGCTCTTCCACGGCTGGAACAGTCGGAGGTGCAGGCGAGGC
AGCAAGCGCGGCGGCGTCACCCGCCGCACAGGCTGGCGGCTCTCCGGCATGGGCAAGGCAGATGCAGCGC
AAACAGACACTCAGCCACGGCACGTCGATGGCCGCCCATGCCGTGCGCTCCGGCGACAGCCATGGCGGCG
GCTCCTCCATCAATCTTTCTGAAAGTGACCGCTCATGA
 Primer design