SecReT4
Protein ID: 310639243
T4SS name [ID]Trb [286]
Gene symbol-
Locus tagEIO_2893
StrainKetogulonicigenium vulgare Y25
Repliconplasmid pYP1 [GenBank: NC_014621] [Browse all T4SS(s) in this replicon]
Location [Strand]19763..20776 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDE3F4R9
KEGG IDkvu:EIO_2893
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.2e-60, Aligned region: 104..320
Protein Sequence: 337 a.a.     [Download]
>gi|310639243|ref|YP_003944002.1| P-type conjugative transfer protein TrbG [Ketogulonicigenium vulgare Y25]
MTRMMARNSGLPVLRKPALAALLLSATMLAGCATNRTPQFSYDADVPALPVVPAAVADDRPRPLHTPPAW
TVARGGTVAGTPTGRVENANAAARVEPRREGYYNAIQIYPWSEGALFQVYAAPGQITTIALEPGESLTGA
GPIAAGDTARWIIGDTESGSGTSRRVHILVKPTREDISTNLVISTDRRVYLIELRARAALYMPAVAWAYP
ALPAGQRQSVPAAPIIPVETARNYRYGLTGDSPPWRPISVFDDGRRVYVVFPRGIVQGEMPPIFVIGSEG
ETQIVNSRIHQNILIVDRLFGAAELRLGSGDRQQTVRIVRIEQRQAAQPAKTGENPS
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|310639221|ref|NC_014621.1|:19763-20776 Ketogulonicigenium vulgare Y25 plasmid pYP1, complete sequence
ATGACCCGCATGATGGCCCGCAATTCCGGCTTGCCGGTTCTCCGTAAACCCGCTTTGGCGGCTTTGTTGC
TGTCCGCCACCATGCTGGCCGGCTGCGCAACCAACCGCACCCCGCAGTTCAGCTATGATGCCGATGTGCC
AGCGTTGCCCGTGGTGCCGGCAGCCGTTGCCGATGACCGGCCTCGACCTTTGCACACACCACCGGCATGG
ACCGTGGCACGCGGCGGAACCGTTGCCGGAACACCGACTGGCCGCGTCGAGAACGCCAATGCCGCCGCCC
GTGTCGAACCACGCCGGGAAGGCTATTACAACGCCATCCAGATCTACCCCTGGTCGGAAGGGGCGCTGTT
TCAGGTCTATGCCGCACCGGGACAGATCACGACAATCGCGCTTGAGCCCGGCGAAAGCCTGACCGGCGCG
GGGCCGATTGCGGCAGGCGACACCGCCCGATGGATCATTGGTGATACCGAAAGCGGATCGGGTACAAGCC
GCCGCGTCCATATCCTTGTGAAACCGACCCGTGAGGATATTTCCACCAATCTTGTCATCAGCACGGATCG
CCGCGTCTATCTCATTGAGCTTCGCGCCCGCGCGGCGCTCTATATGCCCGCTGTGGCCTGGGCCTATCCC
GCGCTACCTGCCGGTCAGCGCCAGAGCGTTCCCGCCGCGCCGATCATCCCTGTCGAGACGGCCCGCAACT
ATCGCTATGGACTGACGGGCGATAGTCCGCCGTGGCGACCCATCTCCGTCTTCGACGATGGCCGCCGTGT
CTATGTCGTCTTCCCGCGCGGCATCGTGCAGGGCGAGATGCCGCCGATCTTCGTCATAGGCTCCGAGGGC
GAGACCCAGATCGTCAACAGCCGCATTCACCAGAACATCCTGATCGTGGATCGCCTGTTCGGTGCTGCCG
AGCTGCGCCTTGGCAGCGGCGATCGCCAGCAGACCGTCAGGATTGTCCGCATTGAACAAAGGCAGGCGGC
CCAGCCCGCAAAGACCGGGGAGAACCCGTCATGA
 Primer design