SecReT4
Protein ID: 311066971
T4SS name [ID]Ydd [618]
Gene symbol-
Locus tagBATR1942_00015
StrainBacillus atrophaeus 1942
Repliconchromosome [GenBank: NC_014639] [Browse all T4SS(s) in this replicon]
Location [Strand]1272..2636 [+]
ProductDNA wielding protein; mobile element region
Component typeYdcQ
UniProt IDE3DZN4
KEGG IDbae:BATR1942_00015
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 4.7e-37, Aligned region: 171..352
AAA_10 [PF12846], Evalue: 9.7e-09, Aligned region: 208..245
Protein Sequence: 454 a.a.     [Download]
>gi|311066971|ref|YP_003971894.1| DNA wielding protein; mobile element region [Bacillus atrophaeus 1942]
MRNNVKLAGAIIFVPVFLLSMIIFWREQLIHFDLNRVIKHFEWNVPLIIKSVLCSLLIAVGSIVASYFLF
FDSYKKILHRQKIAKMIFSNKFYERDNVKVRKLFSNETDTKEKITYFPRMYYQVKNNHIYIRIAMDMSRF
QNRFLDLGKDLENGLFCDLVDKQMEEGFVCFKLLYDVKKNRISIDDAKTEKGVLPLMKHISWQFDKLPHM
LIAGGTGGGKTYFMLTIIKACVGLGTDVRILDPKNADLADLEEVLPKKVYSQKNGILMCLRKSVDGMMER
MDEMKQMPNYKTGENYAYLGLKPVFIFFDEYVAFMDLLDMKERNEALSYMKQLVMLGRQAGYFLVLGAQR
PDAKYLADGIRDQFSFRVSLGLMSETGYGMMFGDVDKAFVNKKETGRGYANVGTGSVLEFYSPIVPKGYD
FMSSIKNALAGVEGAQATAVASGSVSDQTASAKE
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|311066968|ref|NC_014639.1|:1272-2636 Bacillus atrophaeus 1942 chromosome, complete genome
ATGAGAAATAACGTAAAATTAGCAGGCGCAATCATCTTTGTGCCTGTTTTTTTATTGTCTATGATCATCT
TTTGGAGAGAGCAACTGATTCATTTTGATCTTAACCGTGTTATAAAACATTTTGAGTGGAATGTACCTTT
AATCATTAAAAGTGTTTTATGCTCTCTGTTAATTGCTGTTGGAAGTATAGTTGCATCTTACTTTCTTTTC
TTTGACAGCTATAAGAAAATCCTTCACAGGCAAAAGATTGCAAAAATGATTTTCTCCAATAAGTTTTACG
AAAGAGATAATGTGAAAGTAAGAAAACTCTTTTCGAATGAAACTGACACAAAGGAAAAGATCACATACTT
TCCTAGAATGTATTACCAGGTCAAAAACAACCACATTTATATCCGTATTGCTATGGATATGAGCCGTTTT
CAGAATCGCTTCCTAGACTTAGGAAAAGATTTGGAAAACGGCTTATTTTGTGACTTGGTTGATAAGCAAA
TGGAAGAAGGCTTTGTGTGCTTTAAGCTTCTTTATGATGTCAAAAAGAATCGCATTTCCATTGATGACGC
AAAAACTGAGAAAGGCGTCCTTCCGTTAATGAAGCATATCTCATGGCAATTTGATAAGTTGCCGCACATG
CTTATTGCGGGTGGTACAGGTGGAGGGAAAACATACTTCATGCTAACGATCATTAAGGCGTGTGTTGGAC
TGGGGACAGATGTAAGAATATTAGACCCTAAAAATGCAGATTTAGCAGACTTGGAAGAAGTGCTTCCGAA
AAAGGTGTATTCCCAAAAGAACGGTATTCTTATGTGCCTGAGAAAGTCTGTAGATGGCATGATGGAACGA
ATGGATGAAATGAAACAGATGCCTAACTATAAGACAGGTGAAAACTATGCCTATTTAGGCTTAAAACCTG
TTTTTATCTTCTTTGATGAATATGTTGCGTTTATGGATTTGTTAGATATGAAAGAAAGAAATGAAGCCCT
TTCTTACATGAAACAGTTGGTCATGTTGGGAAGACAGGCGGGATATTTTCTTGTTTTGGGGGCACAACGT
CCAGATGCAAAATATTTGGCTGATGGTATTCGTGATCAGTTTAGCTTCCGTGTGTCATTAGGTTTAATGT
CCGAGACTGGATACGGAATGATGTTTGGCGATGTTGATAAGGCATTTGTTAACAAAAAAGAAACTGGACG
AGGATATGCCAATGTTGGCACAGGTTCAGTGTTGGAATTTTACAGCCCTATCGTACCGAAAGGATATGAT
TTTATGTCATCTATTAAAAATGCGCTGGCTGGAGTCGAGGGAGCGCAGGCGACGGCAGTCGCCAGCGGCA
GCGTAAGCGACCAGACGGCCAGCGCGAAGGAGTGA
 Primer design