SecReT4
Protein ID: 311104300
T4SS name [ID]Tfc [723]
Gene symbol-
Locus tagAXYL_01094
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T4SS(s) in this replicon]
Location [Strand]1165434..1166024 [+]
Producttransglycosylase SLT domain-containing protein 2
Component typeTfc4
UniProt IDE3HKR3
KEGG IDaxy:AXYL_01094
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|311104300|ref|YP_003977153.1| transglycosylase SLT domain-containing protein 2 [Achromobacter xylosoxidans A8]
MATPAVTALLRALALTAGLFACAAHAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGMRRNGRIVPWPWT
LNVAGQSRRFATRADACAGLQQAMRSTPPTRIDAGLGQINLGYHPHRYTHACDLLDPYRNLASAAEILKE
QYTPGEDWLLAMGRYHRPAGGEPAARYRRSVSRHLARVQGTHSIATARAVRQESTP
 
Nucleotide Sequence: 591 bp     [Download]
>ref|NC_014640.1|:1165434-1166024 transglycosylase SLT domain-containing protein 2 [Achromobacter xylosoxidans A8]
ATGGCAACGCCAGCCGTAACGGCGCTGCTGCGCGCACTGGCGCTCACTGCGGGCCTGTTCGCCTGCGCCG
CCCATGCCCAGGAGGTTCCGCCACCGGCCTACCAGCTTGCCGCACAGCGCGCGGGCATTCCCTCGACGGT
GCTCTACGCCGTGGCCTTGCAGGAGAGCGGCATGCGACGCAATGGACGCATCGTCCCATGGCCGTGGACC
CTGAATGTCGCCGGCCAGTCGCGGCGCTTCGCCACCCGTGCCGATGCCTGCGCCGGTTTGCAGCAGGCGA
TGCGATCTACGCCACCCACGCGCATCGACGCGGGCCTGGGCCAGATCAACCTGGGCTACCACCCGCACCG
CTACACCCATGCCTGCGACTTGTTGGACCCGTACCGCAATCTCGCCAGCGCCGCCGAGATCCTCAAGGAG
CAGTACACCCCCGGTGAAGACTGGCTGCTGGCCATGGGCCGCTACCACCGGCCCGCGGGCGGTGAGCCTG
CCGCCCGCTATCGACGCAGCGTATCCCGACACCTCGCCCGCGTGCAGGGCACGCACTCAATCGCCACGGC
GCGAGCCGTGCGTCAGGAGTCGACCCCATGA
 Primer design