SecReT4
Protein ID: 311104303
T4SS name [ID]Tfc [723]
Gene symbol-
Locus tagAXYL_01097
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T4SS(s) in this replicon]
Location [Strand]1168751..1169500 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDE3HKR6
KEGG IDaxy:AXYL_01097
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 7e-70, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|311104303|ref|YP_003977156.1| hypothetical protein AXYL_01097 [Achromobacter xylosoxidans A8]
MKDAASTAQREQNQRQGLIVGTITLPFRLLGVLIGSLLFSIVVECVGMHLFWKDQGWRHSQQMLQYELGH
LSNHFTRSVVVQEPGRTAHELVDTGYGWVFVRSGLLERMSQTAERARAPSREPTRNFRYYISQAYVWAES
YLIAAAFTTLTFLVRLLVLVLTLPLILTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPLAVLP
WITYLALPISVHPLLILLPSAALLGLAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>ref|NC_014640.1|:1168751-1169500 hypothetical protein AXYL_01097 [Achromobacter xylosoxidans A8]
ATGAAGGATGCCGCCTCGACCGCGCAGCGGGAGCAGAACCAGCGCCAGGGGCTGATCGTCGGCACCATCA
CCTTGCCGTTCAGGCTGCTCGGGGTGCTGATCGGTTCGCTGCTGTTCTCGATCGTGGTGGAGTGCGTCGG
CATGCACCTGTTCTGGAAGGACCAGGGCTGGCGCCACTCCCAGCAGATGCTGCAGTACGAACTCGGGCAC
CTGTCGAACCACTTCACGCGCAGCGTGGTGGTGCAGGAGCCCGGGCGCACGGCGCACGAGCTGGTGGATA
CCGGGTACGGGTGGGTGTTCGTGCGCTCGGGGTTGCTGGAGCGCATGAGCCAGACCGCCGAGCGCGCCCG
TGCGCCCAGCCGCGAGCCGACGCGCAACTTCCGCTATTACATCAGCCAGGCCTATGTCTGGGCCGAGAGC
TACCTGATCGCCGCGGCCTTCACGACGCTCACGTTCCTCGTGCGCCTGCTGGTCCTGGTGCTCACGCTGC
CGCTGATCCTCACTGCGGCATTCGTCGGCCTGATCGACGGCCTGGTGCGGCGGGACGTGCGGCGGTTCGG
CGCGGGCCGGGAATCCGGCTTCATCTACCACCGCGCGAAAGCGAGCCTGATGCCGCTGGCCGTGCTGCCC
TGGATCACCTACCTCGCGCTGCCGATCTCGGTGCATCCGCTGCTGATCCTGCTGCCCAGCGCAGCCTTGC
TGGGACTGGCCGTGAGCCTGACCGCGGGCAGCTTCAAAAAGTACCTCTAG
 Primer design