SecReT4
Protein ID: 311104304
T4SS name [ID]Tfc [723]
Gene symbol-
Locus tagAXYL_01098
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T4SS(s) in this replicon]
Location [Strand]1169599..1169982 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDE3HKR7
KEGG IDaxy:AXYL_01098
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 8.1e-29, Aligned region: 29..109
Protein Sequence: 127 a.a.     [Download]
>gi|311104304|ref|YP_003977157.1| hypothetical protein AXYL_01098 [Achromobacter xylosoxidans A8]
MLASIWLRAAHRGVPTFLVTALVLGRSPMALAESPAQRQELVAALRQLDALERTVADSAAHTPITPGERY
HFDYPRLQADLARVRAGIQFHLTPSRAQPRAPSELAGEYRTERATEPLPATTAEGKQ
 
Nucleotide Sequence: 384 bp     [Download]
>ref|NC_014640.1|:1169599-1169982 hypothetical protein AXYL_01098 [Achromobacter xylosoxidans A8]
ATGTTGGCTTCGATCTGGCTGCGCGCCGCGCATCGCGGCGTGCCCACTTTTCTCGTGACGGCCCTCGTGC
TGGGCCGGTCCCCGATGGCCTTGGCCGAGTCCCCGGCGCAGCGCCAGGAGTTGGTCGCCGCGCTGCGCCA
GCTCGACGCGCTGGAACGCACCGTCGCGGACAGCGCCGCGCATACCCCCATCACACCGGGCGAGCGCTAC
CACTTCGATTACCCGCGGCTCCAGGCTGACTTGGCGCGCGTGCGCGCCGGCATCCAATTTCACCTGACGC
CATCGCGCGCTCAACCGCGCGCCCCCTCCGAACTGGCCGGCGAATACCGCACCGAACGGGCGACCGAGCC
GCTGCCGGCGACGACTGCGGAGGGCAAGCAATGA
 Primer design