SecReT4
Protein ID: 311104307
T4SS name [ID]Tfc [723]
Gene symbol-
Locus tagAXYL_01101
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T4SS(s) in this replicon]
Location [Strand]1170600..1170998 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDE3HKS0
KEGG IDaxy:AXYL_01101
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.1e-48, Aligned region: 10..130
Protein Sequence: 132 a.a.     [Download]
>gi|311104307|ref|YP_003977160.1| hypothetical protein AXYL_01101 [Achromobacter xylosoxidans A8]
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTIALAPTFVVLG
VALGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRHPLMAGWVGGHVLISRSGFWSTRRSMR
 
Nucleotide Sequence: 399 bp     [Download]
>ref|NC_014640.1|:1170600-1170998 hypothetical protein AXYL_01101 [Achromobacter xylosoxidans A8]
ATGTCCGAGCAGCAGCACGTCCGTGCGGACGGAACGGTCACCTTCCTTCCGCACCGGCTCAACCGCCATC
CCGTTGTGGTGCGCGGCCTCACCGCTGACGAACTCTGGATTTGCTGCGGCCTGTCCGGTGCCGCCGGCCT
GCTGGTCGGCGCGCCGCTGTCCTGGGTGTTCCGCACGATCGCGCTGGCGCCGACCTTCGTCGTCCTGGGC
GTGGCGCTCGGCGTCTTCATCGGCGGCGGCATCCTGCGCCGCCTCAAGCGTGGGCGTCCCGACACCTGGC
TGTATCGGCAACTGCAATGGCGCATCGCCACGCGCCATCCGCTGATGGCCGGCTGGGTGGGTGGCCATGT
GCTGATCTCGCGCTCGGGCTTCTGGTCCACCCGCAGGAGCATGCGATGA
 Primer design