SecReT4
Protein ID: 311104317
T4SS name [ID]Tfc [723]
Gene symbol-
Locus tagAXYL_01111
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T4SS(s) in this replicon]
Location [Strand]1180342..1181736 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDE3HKT0
KEGG IDaxy:AXYL_01111
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 464 a.a.     [Download]
>gi|311104317|ref|YP_003977170.1| hypothetical protein AXYL_01111 [Achromobacter xylosoxidans A8]
MKRPEPMNLSAKACRLLRPTALAGTLALVCGMAWAQVGYQNSGPVLGDDVMYSIGGGSAVSMGRAAGMRS
IGVGVGWNSNLICGDMSIQTTLRNQLNGITNGFQQIMSNVIQSATSAVASLPALIIQRADPGLYNLLTNG
VLQARLDFDRSKLTCRAMAEKMAETAGGQLGWSQMAEGMALRDAVGSNDAVSAVEQAETRRGNDGVPWVG
GSNAGGAGQSAIRVVGDVTRAGYNLVNGRGVTDTSSIASTSCASLSCQTWTSPQQATEWATRALGEQVQR
TCDSCTKTETVPGVGLTPLIQEEYEAKLEVLQELVSGTRNTTFENLREAGSTSLPITRGVIEALRDEPDQ
DLLARRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANELAVQAVNHESDTLDREIRNLKTELELRREL
ANNSPMAIIQRHGTRAAGSRGIYEGDPVPDRLDQLQKGNPGARP
 
Nucleotide Sequence: 1395 bp     [Download]
>ref|NC_014640.1|:1180342-1181736 hypothetical protein AXYL_01111 [Achromobacter xylosoxidans A8]
ATGAAGCGTCCTGAACCGATGAACCTTTCCGCCAAGGCGTGCCGCCTGCTGCGCCCGACGGCGCTGGCCG
GCACGCTCGCTCTGGTCTGCGGCATGGCGTGGGCGCAGGTCGGATACCAGAACAGCGGCCCCGTCCTCGG
CGATGACGTCATGTACTCGATCGGCGGTGGCAGTGCGGTGTCCATGGGCCGCGCGGCCGGCATGCGTTCC
ATCGGGGTCGGCGTGGGGTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCCAGACCACGCTGCGCA
ATCAGCTTAACGGCATCACGAACGGCTTTCAGCAGATCATGAGCAACGTGATCCAGAGCGCGACCAGCGC
GGTTGCATCGCTGCCGGCGCTGATCATTCAGCGCGCCGATCCGGGCCTGTACAACCTGCTGACTAACGGC
GTGCTGCAGGCGCGGCTGGACTTCGACCGCTCCAAGCTGACGTGCCGCGCCATGGCGGAGAAGATGGCCG
AGACGGCGGGTGGCCAGCTTGGCTGGAGCCAGATGGCCGAAGGCATGGCCCTGCGTGACGCGGTTGGCAG
CAACGATGCCGTATCGGCCGTCGAGCAGGCCGAGACGCGCCGCGGCAACGACGGCGTGCCCTGGGTGGGC
GGCAGCAATGCCGGTGGCGCGGGCCAGTCCGCCATCCGGGTGGTCGGCGACGTCACCCGCGCGGGCTACA
ACCTGGTCAACGGTCGCGGCGTGACGGACACCTCCTCCATCGCGTCCACCAGTTGCGCGAGCCTGTCCTG
CCAGACCTGGACGTCGCCGCAGCAGGCGACCGAATGGGCCACGCGCGCCCTCGGAGAGCAGGTGCAGCGC
ACGTGCGACTCCTGCACTAAGACCGAGACGGTGCCCGGCGTCGGGCTGACGCCGCTGATCCAGGAGGAGT
ACGAAGCCAAGCTGGAGGTCTTGCAGGAGCTGGTTTCCGGCACGCGTAATACCACCTTCGAGAACTTGCG
CGAGGCCGGCAGCACGTCGCTGCCGATCACCCGCGGCGTGATCGAGGCGCTGCGCGACGAGCCGGACCAG
GACCTGCTGGCGCGGCGCCTCGCGTCCGAAGTGGCGCTGTCATCGGTGCTGGAGAAGGCGCTCCTGCTCC
AACGCACGCTGCTCACGGGCAAGAAGGAGCCCAACGTCGCAGCCAACGAACTTGCGGTGCAGGCCGTGAA
CCATGAGAGCGACACGCTCGACCGGGAGATCCGCAACCTGAAGACGGAATTGGAGCTGCGGCGCGAACTG
GCGAACAACTCGCCGATGGCCATCATCCAGCGCCACGGCACGCGGGCGGCCGGCTCGCGCGGCATCTACG
AGGGCGATCCGGTACCCGACCGCCTTGACCAGTTGCAGAAGGGCAATCCCGGAGCCAGGCCATGA
 Primer design