SecReT4
Protein ID: 311109689
T4SS name [ID]Trb [51]
Gene symboltrbC
Locus tagAXYL_06537
StrainAchromobacter xylosoxidans A8
Repliconplasmid pA81 [GenBank: NC_014641] [Browse all T4SS(s) in this replicon]
Location [Strand]3449..3913 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ5GRF3, E3HXM2
KEGG IDaxy:AXYL_06537
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4e-18, Aligned region: 17..110
Protein Sequence: 154 a.a.     [Download]
>gi|311109689|ref|YP_003982541.1| conjugal transfer protein TrbC [Achromobacter xylosoxidans A8]
MQSTLPAFRFDSRAVFYLGMFALLAFFLLAPQHAFASEGTGGSLPYEGWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGVLHQAKVAALDMAGFPG
EAIARWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>ref|NC_014641.1|:3449-3913 conjugal transfer protein TrbC [Achromobacter xylosoxidans A8]
ATGCAATCGACCCTTCCCGCGTTCCGCTTCGACAGCCGCGCCGTGTTCTACCTGGGCATGTTCGCCCTCT
TGGCGTTCTTCCTGCTGGCCCCCCAGCACGCTTTCGCCTCCGAAGGCACCGGCGGTTCCCTGCCGTATGA
AGGCTGGTTGACCAACCTGCGCAACAGCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTTGTCGCCGGCGGCATCTTGATCTTCGGCGGCGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCCCTGCTGGTCGGCGCGCAGAACATGATGAGCACCTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGTGCTGCACCAGGCCAAGGTCGCGGCGCTGGACATGGCCGGCTTCCCTGGT
GAAGCCATCGCACGCTGGGCCGAACGCGGCCACATCGCGGGGTAA
 Primer design