SecReT4
Protein ID: 311109693
T4SS name [ID]Trb [51]
Gene symboltrbG
Locus tagAXYL_06541
StrainAchromobacter xylosoxidans A8
Repliconplasmid pA81 [GenBank: NC_014641] [Browse all T4SS(s) in this replicon]
Location [Strand]7565..8479 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDQ5GRE9, E3HXM6
KEGG IDaxy:AXYL_06541
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.1e-64, Aligned region: 79..303
Protein Sequence: 304 a.a.     [Download]
>gi|311109693|ref|YP_003982545.1| P-type conjugative transfer protein TrbG [Achromobacter xylosoxidans A8]
MNPRTFTMKKIFSVVALGAALLSPTLALAADDLADKYFTGKNPTLTPQERAAIDIAKRWNAGAATGMKPV
AGSNGAIKFLFGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGPNEVQHLIIKPMD
VGLETSLIVTTNRRAYHLRLRSHRTEYMPQVSFTYPEDALAKWDAIQRRETQERTDRTIPQTGEYLGDLK
FDYDLSGSASWKPVRVFNDGRKTIIEMPGTMEQTEAPTLLVVRREGGIFRDEETVMVNYRVQGNRYIVDT
VFDRAILIAGVGGSQDRVTISRRK
 
Nucleotide Sequence: 915 bp     [Download]
>ref|NC_014641.1|:7565-8479 P-type conjugative transfer protein TrbG [Achromobacter xylosoxidans A8]
ATGAACCCAAGGACATTCACCATGAAGAAAATCTTTTCCGTTGTCGCCTTGGGCGCTGCGCTGCTGTCGC
CCACCCTGGCCCTGGCCGCCGATGACCTGGCCGACAAGTATTTCACCGGCAAGAACCCGACGCTGACGCC
TCAAGAGCGCGCGGCCATCGACATTGCGAAGCGATGGAACGCGGGCGCTGCCACCGGCATGAAGCCCGTC
GCCGGCTCCAATGGCGCGATCAAGTTCCTGTTCGGCGCGCAGCAGCCCAGCATCGTGTGCGCGGTGCTCC
AGGTGTGCGACGTGGCCTTGCAGCCAGGCGAGCAAGTCAACTCGATCAACCTGGGCGACACGGCCCGGTG
GACGGTCGAGCCGGCCATCACCGGCAGCGGCCCCAACGAAGTGCAGCACCTCATCATCAAGCCGATGGAT
GTTGGCCTGGAAACCAGCCTCATCGTGACGACGAACCGCCGCGCCTATCACCTGCGCCTGCGCTCGCATC
GCACCGAGTACATGCCGCAAGTCTCGTTCACCTACCCCGAGGACGCGCTTGCGAAGTGGGACGCGATCCA
GCGCCGCGAAACGCAAGAACGCACCGACCGCACCATCCCGCAGACCGGCGAGTACCTGGGCGATCTCAAG
TTCGACTATGACCTGTCCGGCTCGGCGAGCTGGAAGCCGGTGCGTGTGTTCAACGATGGCCGCAAGACCA
TCATCGAAATGCCCGGAACGATGGAGCAAACCGAAGCGCCGACGCTCCTGGTCGTGCGCCGCGAGGGCGG
CATCTTCCGCGACGAGGAAACCGTGATGGTGAACTATCGCGTGCAGGGCAATCGCTACATCGTGGACACG
GTGTTTGACCGCGCGATCCTGATTGCCGGTGTTGGTGGAAGCCAAGACCGCGTGACTATCTCCCGGAGGA
AGTGA
 Primer design