SecReT4
Protein ID: 311109698
T4SS name [ID]Trb [51]
Gene symboltrbL
Locus tagAXYL_06546
StrainAchromobacter xylosoxidans A8
Repliconplasmid pA81 [GenBank: NC_014641] [Browse all T4SS(s) in this replicon]
Location [Strand]11359..13077 [+]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDE3HXN1
KEGG IDaxy:AXYL_06546
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.8e-40, Aligned region: 64..278
Protein Sequence: 572 a.a.     [Download]
>gi|311109698|ref|YP_003982550.1| P-type conjugative transfer protein TrbL [Achromobacter xylosoxidans A8]
MRMPASLKLALPLLVWLAFFSTDASAQMNSSGLFDDVLNRYNAAASGWAGVITNAASWLFWLLVTISMVW
TFGMMALRKADIGEFFAELVRFTIFTGFFWWLLTNGPNFASTIYASLRQIAGNATGLGQALSPSGIVDIG
FAIFYKVMDQSSVWSPVDSMAGILMAVAILIVLALIGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDMA
INYYKTVLGVAAQLMAMVLLVGIGKTFLDDYYARMSEGINLKEMGVMLIVCVILLALVNKIPALIAGVIT
GASVGGAGIGNFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSSGSDVMSML
GGGGGGDSGGGGGGEAGTSTPLGQAAGFGGGGGDSGGGGSSGGESKGGDKGGDKAGGDKAGSSSKGGEGG
GQKASGGGDAGGAKAGQGGGQGQGAGQGGQQDAPGSTGPGMLASAASALGKAGRVTADAGANLAKGVGAV
AAAKAASMRDSAMERIADTTGGKIAAAIKAQGGSSADTSIDVPDQQPSPTFGDNSLAGADSSADPESEVA
AFRDGGRNDKSA
 
Nucleotide Sequence: 1719 bp     [Download]
>ref|NC_014641.1|:11359-13077 P-type conjugative transfer protein TrbL [Achromobacter xylosoxidans A8]
ATGAGAATGCCAGCCAGCTTGAAACTCGCCCTGCCGCTGCTCGTTTGGCTGGCGTTCTTTTCTACGGACG
CTTCCGCCCAAATGAACAGCTCGGGCCTCTTCGATGACGTTCTGAACCGCTACAACGCCGCCGCCAGCGG
CTGGGCCGGTGTCATCACCAACGCCGCATCCTGGTTGTTCTGGCTGCTGGTGACGATCTCGATGGTCTGG
ACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGGGAGTTCTTCGCGGAGCTTGTCCGCTTCACCA
TCTTCACCGGCTTCTTCTGGTGGTTGCTGACGAACGGCCCTAACTTCGCCTCGACCATCTATGCGTCGCT
ACGCCAAATTGCCGGCAACGCGACGGGCTTGGGTCAAGCCTTGTCGCCTTCCGGCATTGTCGATATTGGC
TTTGCCATCTTCTACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCATCC
TCATGGCCGTTGCCATCTTGATCGTGCTCGCGCTCATCGGCGTGAACATGCTTCTTCTCCTGGCGTCTGG
TTGGGTGCTCGCCTATGGCGGCGTGTTCTTCCTCGGCTTCGGTGGGTCGCGGTGGACTTCCGACATGGCG
ATCAACTACTACAAGACCGTGCTGGGTGTGGCCGCGCAGCTCATGGCAATGGTGCTGCTGGTCGGCATCG
GCAAGACCTTTCTGGATGACTACTACGCGCGCATGAGCGAGGGGATCAACCTCAAGGAAATGGGCGTGAT
GCTCATCGTCTGCGTGATCCTGCTGGCACTCGTCAACAAGATTCCGGCGCTCATCGCCGGCGTCATCACC
GGCGCGAGCGTGGGCGGTGCCGGCATCGGCAACTTCGGCGCAGGCGCGGCCCTCGGTGCCGCTGGCATGG
CGGCCGCAGCAGCGGCAACCGGCGGCGCTGCTCTGGCGGCCGGCGCGGCCTCGGCCGCCGGCGGTGCTTC
TGCGGTCATGGCCGCGTTCTCGAAGGCCAATGAAAACGTCTCGTCCGGGTCGGATGTCATGTCCATGCTG
GGCGGTGGTGGTGGCGGCGACTCTGGCGGTGGTGGTGGCGGTGAAGCCGGCACCAGCACGCCCCTGGGCC
AAGCCGCCGGCTTCGGTGGCGGCGGTGGCGACTCTGGCGGCGGCGGCAGCAGCGGCGGCGAGTCGAAGGG
CGGCGACAAAGGCGGCGACAAGGCCGGCGGCGATAAGGCCGGCTCCAGCTCGAAGGGTGGCGAAGGCGGC
GGCCAGAAGGCCAGCGGCGGCGGTGACGCCGGCGGCGCGAAGGCCGGCCAGGGTGGCGGCCAGGGCCAGG
GAGCGGGGCAGGGCGGCCAGCAGGACGCACCTGGTAGTACCGGCCCCGGCATGCTGGCCTCGGCCGCTTC
CGCGCTTGGCAAGGCCGGCCGCGTCACGGCCGACGCCGGCGCGAACTTGGCGAAGGGTGTAGGTGCGGTG
GCGGCCGCGAAGGCCGCCAGCATGCGCGACTCGGCGATGGAACGCATCGCCGACACCACCGGCGGAAAGA
TCGCGGCCGCGATCAAGGCGCAGGGCGGCAGCTCGGCCGACACGAGCATCGACGTGCCCGATCAACAACC
CTCGCCGACCTTCGGCGACAACAGCCTGGCCGGAGCTGACAGCTCTGCCGATCCCGAGTCCGAAGTAGCC
GCGTTCCGTGACGGCGGCCGCAACGACAAATCTGCGTAA
 Primer design