SecReT4
Protein ID: 312193403
T4SS name [ID]MagB [452]
Gene symbol-
Locus tagD11S_2356
StrainAggregatibacter actinomycetemcomitans D11S-1
Repliconplasmid S57 [GenBank: NC_014629] [Browse all T4SS(s) in this replicon]
Location [Strand]20700..20924 [-]
Productlipoprotein
Component typeMagB05
UniProt IDD0UIW8
KEGG IDaat:D11S_2356
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 74 a.a.     [Download]
>gi|312193403|ref|YP_003966129.1| lipoprotein [Aggregatibacter actinomycetemcomitans D11S-1]
MKKLLMMVTLTFLVSACSEEVKSIDYYKEHTTERLKMLEECEKKAEPLMANSNCRNANKAQASIRRSNIR
GGNY
 
Nucleotide Sequence: 225 bp     [Download]
>gi|312193364|ref|NC_014629.1|:c20924-20700 Aggregatibacter actinomycetemcomitans D11S-1 plasmid S57, complete sequence
ATGAAAAAATTACTTATGATGGTTACATTAACTTTTTTAGTATCTGCCTGTTCTGAAGAAGTCAAAAGTA
TAGACTACTATAAAGAACATACGACAGAACGTTTAAAAATGTTAGAAGAATGTGAGAAAAAAGCCGAACC
GCTGATGGCAAATTCTAATTGTCGAAACGCAAATAAAGCTCAAGCAAGTATTCGTCGTTCGAATATTCGC
GGAGGAAATTATTAG
 Primer design